DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dock and Srms

DIOPT Version :10

Sequence 1:NP_722657.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001011961.1 Gene:Srms / 296472 RGDID:1306602 Length:507 Species:Rattus norvegicus


Alignment Length:198 Identity:53/198 - (26%)
Similarity:84/198 - (42%) Gaps:62/198 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 ALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQG--QVGLVPRNYLQELNDYLATPYR 393
            |||.||:...:|||..:||||..:   ..:.::..|:...|  ..||||..||.:     |||  
  Rat    73 ALYDFTARCAEELSVSRGDRLYAL---KEEGEYIFAQRLSGPPSTGLVPVTYLAK-----ATP-- 127

  Fly   394 NASASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQC 458
                                                     ..|.::|      ||:..|:|:|.
  Rat   128 -----------------------------------------ETPSDQP------WYFNGISRTQA 145

  Fly   459 DTVLNGHGH-DGDFLIRDSETNMGDYSVSLKAPGRNKHFRVHVEQN--MYCIGQRKFHSLDQLVD 520
            ..:|....: .|.||||.||:::|.||:|::|..:..|:|:.:..:  :|....|.|.|||.|:.
  Rat   146 QQLLLSPANAPGAFLIRPSESSIGGYSLSVRAQAKVCHYRICMAPSGGLYLQEGRLFPSLDALLA 210

  Fly   521 HYQ 523
            :|:
  Rat   211 YYK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dockNP_722657.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701 20/53 (38%)
SH2_Nck_family 446..538 CDD:198196 28/81 (35%)
SrmsNP_001011961.1 SH3 70..124 CDD:473055 20/53 (38%)
SH2 134..212 CDD:472789 28/83 (34%)
PTKc_Srm_Brk 238..498 CDD:133248
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.