DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dock and Sla

DIOPT Version :9

Sequence 1:NP_001259845.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_017172011.1 Gene:Sla / 20491 MGIID:104295 Length:320 Species:Mus musculus


Alignment Length:199 Identity:45/199 - (22%)
Similarity:76/199 - (38%) Gaps:66/199 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 DIVVALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARN-NQGQVGLVPRNYLQELNDYLAT 390
            |.:..|..:.|.:.....|.:|::|.::   :.:..|:||.: :.|:...:|       ...:|.
Mouse    64 DFLAVLTDYPSPDISPPIFRRGEKLRVI---SDEGGWWKAISLSTGRESYIP-------GICVAR 118

  Fly   391 PYRNASASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITR 455
            .|               :|....|.|.|..|              :.::.|              
Mouse   119 VY---------------HGWLFEGLGRDKAE--------------ELLQLP-------------- 140

  Fly   456 SQCDTVLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRV-HVEQNMYCIGQR-KFHSLDQL 518
               ||.:      |.|:||:|||..|.||:|:: ..:.||:|: .:..|.|.|..| .|..|:.|
Mouse   141 ---DTKI------GSFMIRESETKKGFYSLSVR-HRQVKHYRIFRLPNNWYYISPRLTFQCLEDL 195

  Fly   519 VDHY 522
            |.||
Mouse   196 VTHY 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dockNP_001259845.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701 10/55 (18%)
SH2_Nck_family 446..538 CDD:198196 26/79 (33%)
SlaXP_017172011.1 SH3_SLAP 65..119 CDD:212943 11/63 (17%)
SH2_SLAP 112..209 CDD:198207 35/148 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.