Sequence 1: | NP_001259845.1 | Gene: | dock / 33262 | FlyBaseID: | FBgn0010583 | Length: | 548 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017172011.1 | Gene: | Sla / 20491 | MGIID: | 104295 | Length: | 320 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 45/199 - (22%) |
---|---|---|---|
Similarity: | 76/199 - (38%) | Gaps: | 66/199 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 327 DIVVALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARN-NQGQVGLVPRNYLQELNDYLAT 390
Fly 391 PYRNASASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITR 455
Fly 456 SQCDTVLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRV-HVEQNMYCIGQR-KFHSLDQL 518
Fly 519 VDHY 522 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dock | NP_001259845.1 | SH3_Nck_1 | 154..204 | CDD:212699 | |
SH3_Nck_2 | 256..308 | CDD:212700 | |||
SH3_Nck_3 | 328..383 | CDD:212701 | 10/55 (18%) | ||
SH2_Nck_family | 446..538 | CDD:198196 | 26/79 (33%) | ||
Sla | XP_017172011.1 | SH3_SLAP | 65..119 | CDD:212943 | 11/63 (17%) |
SH2_SLAP | 112..209 | CDD:198207 | 35/148 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167838357 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |