Sequence 1: | NP_001259845.1 | Gene: | dock / 33262 | FlyBaseID: | FBgn0010583 | Length: | 548 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001276371.1 | Gene: | Grap2 / 17444 | MGIID: | 1333842 | Length: | 322 | Species: | Mus musculus |
Alignment Length: | 203 | Identity: | 50/203 - (24%) |
---|---|---|---|
Similarity: | 85/203 - (41%) | Gaps: | 66/203 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 331 ALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPRNYLQELNDYLATPYRNA 395
Fly 396 SASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQCDT 460
Fly 461 VLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRVHVE-QNMYCIGQRKFHSLDQLVDHYQR 524
Fly 525 APIYTNKQ 532 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dock | NP_001259845.1 | SH3_Nck_1 | 154..204 | CDD:212699 | |
SH3_Nck_2 | 256..308 | CDD:212700 | |||
SH3_Nck_3 | 328..383 | CDD:212701 | 18/51 (35%) | ||
SH2_Nck_family | 446..538 | CDD:198196 | 29/88 (33%) | ||
Grap2 | NP_001276371.1 | SH3 | 2..53 | CDD:302595 | 18/106 (17%) |
SH2_Grb2_like | 54..147 | CDD:199828 | 31/95 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 143..216 | 50/203 (25%) | |||
SH3_GRAP2_C | 267..319 | CDD:212883 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167838361 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |