DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dock and Grap2

DIOPT Version :9

Sequence 1:NP_001259845.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001276371.1 Gene:Grap2 / 17444 MGIID:1333842 Length:322 Species:Mus musculus


Alignment Length:203 Identity:50/203 - (24%)
Similarity:85/203 - (41%) Gaps:66/203 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 ALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPRNYLQELNDYLATPYRNA 395
            |.:.|.::.:.||||..||.|:|:   ::..:|.||... .|.|.||:|::.             
Mouse     5 AKFDFMASGEDELSFRTGDILKIL---SNQEEWLKAELG-SQEGYVPKNFID------------- 52

  Fly   396 SASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQCDT 460
                                                      ||.|     .|::..::|.|.:.
Mouse    53 ------------------------------------------IEFP-----EWFHEGLSRHQAEN 70

  Fly   461 VLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRVHVE-QNMYCIGQRKFHSLDQLVDHYQR 524
            :|.|. ..|.|:||.|:::.||:|:|::.....:||:|..: :..|.:...||.||::|||:|:.
Mouse    71 LLMGK-DIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRT 134

  Fly   525 APIYTNKQ 532
            ..|...||
Mouse   135 TSISKQKQ 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dockNP_001259845.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701 18/51 (35%)
SH2_Nck_family 446..538 CDD:198196 29/88 (33%)
Grap2NP_001276371.1 SH3 2..53 CDD:302595 18/106 (17%)
SH2_Grb2_like 54..147 CDD:199828 31/95 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..216 50/203 (25%)
SH3_GRAP2_C 267..319 CDD:212883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.