Sequence 1: | NP_001259845.1 | Gene: | dock / 33262 | FlyBaseID: | FBgn0010583 | Length: | 548 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006604.1 | Gene: | GRAP / 10750 | HGNCID: | 4562 | Length: | 217 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 59/204 - (28%) |
---|---|---|---|
Similarity: | 89/204 - (43%) | Gaps: | 63/204 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 330 VALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPRNYLQELNDYLATPYRN 394
Fly 395 ASASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQCD 459
Fly 460 TVLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRVHVE-QNMYCIGQRKFHSLDQLVDHYQ 523
Fly 524 RAPIYTNKQ 532 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dock | NP_001259845.1 | SH3_Nck_1 | 154..204 | CDD:212699 | |
SH3_Nck_2 | 256..308 | CDD:212700 | |||
SH3_Nck_3 | 328..383 | CDD:212701 | 24/52 (46%) | ||
SH2_Nck_family | 446..538 | CDD:198196 | 33/88 (38%) | ||
GRAP | NP_006604.1 | SH3_GRAP_N | 2..55 | CDD:212881 | 24/52 (46%) |
SH2_Grb2_like | 56..150 | CDD:199828 | 35/106 (33%) | ||
SH3_GRAP_C | 162..214 | CDD:212884 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165148269 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |