Sequence 1: | NP_001259845.1 | Gene: | dock / 33262 | FlyBaseID: | FBgn0010583 | Length: | 548 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009304328.1 | Gene: | sla2a / 100536664 | ZFINID: | ZDB-GENE-141216-296 | Length: | 254 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 41/206 - (19%) |
---|---|---|---|
Similarity: | 73/206 - (35%) | Gaps: | 71/206 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 330 VALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYK-ARNNQGQVGLVPRNYLQELNDYLATPYR 393
Fly 394 NASASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQC 458
Fly 459 DTVLN-GHGHDGDFLIRDSETNMGDYSVSLKAPGRNK----HFRVHVEQN--MYCIGQRKFHSLD 516
Fly 517 QLVDHYQRAPI 527 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dock | NP_001259845.1 | SH3_Nck_1 | 154..204 | CDD:212699 | |
SH3_Nck_2 | 256..308 | CDD:212700 | |||
SH3_Nck_3 | 328..383 | CDD:212701 | 15/53 (28%) | ||
SH2_Nck_family | 446..538 | CDD:198196 | 25/89 (28%) | ||
sla2a | XP_009304328.1 | SH3 | 32..86 | CDD:302595 | 15/54 (28%) |
SH2 | 79..180 | CDD:301589 | 28/158 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170582191 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |