DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dock and sla2a

DIOPT Version :9

Sequence 1:NP_001259845.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_009304328.1 Gene:sla2a / 100536664 ZFINID:ZDB-GENE-141216-296 Length:254 Species:Danio rerio


Alignment Length:206 Identity:41/206 - (19%)
Similarity:73/206 - (35%) Gaps:71/206 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 VALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYK-ARNNQGQVGLVPRNYLQELNDYLATPYR 393
            |||.:|.|....|.:...||:|.|:   :.|.|..: ...:.|....:|..|:.:::|       
Zfish    34 VALCNFPSFRSDEHTICLGDKLNII---SEDDDMLRVCSTSTGNECFIPHTYVSKVHD------- 88

  Fly   394 NASASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQC 458
                                                                 .|::..|:|...
Zfish    89 -----------------------------------------------------QWFFEGISRRNA 100

  Fly   459 DTVLN-GHGHDGDFLIRDSETNMGDYSVSLKAPGRNK----HFRVHVEQN--MYCIGQRKFHSLD 516
            :.:|. ...:.|.||||:|::..|.||:|::......    |::::...|  .|......|.:|.
Zfish   101 EQLLMLPQNYSGCFLIRESQSFPGLYSLSVRQHSGQMHTVLHYKIYQLHNGWFYIQPNHPFSTLS 165

  Fly   517 QLVDHYQRAPI 527
            ||||:|.|:.:
Zfish   166 QLVDYYSRSSV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dockNP_001259845.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701 15/53 (28%)
SH2_Nck_family 446..538 CDD:198196 25/89 (28%)
sla2aXP_009304328.1 SH3 32..86 CDD:302595 15/54 (28%)
SH2 79..180 CDD:301589 28/158 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.