DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dock and grap

DIOPT Version :9

Sequence 1:NP_001259845.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001332868.1 Gene:grap / 100127598 XenbaseID:XB-GENE-6258733 Length:219 Species:Xenopus tropicalis


Alignment Length:200 Identity:55/200 - (27%)
Similarity:87/200 - (43%) Gaps:65/200 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 ALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPRNYLQELNDYLATPYRNA 395
            |:|:|.:....||.|:|||.::|::. ..|.:|:|| ...|:.|.:|:||::.            
 Frog     5 AIYNFKTTERDELPFKKGDIIKILNM-EDDQNWFKA-ELFGREGYIPKNYIKV------------ 55

  Fly   396 SASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQCDT 460
                                            ||                ..||.|.|:|...:.
 Frog    56 --------------------------------KP----------------HPWYAGRISRQVAEE 72

  Fly   461 VLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRV--HVEQN-MYCIGQRKFHSLDQLVDHY 522
            :|......|.|||||||::.||:|:|:......:||:|  ..|.| .|.:.:.||:||::|||:|
 Frog    73 ILLKRNFVGAFLIRDSESSPGDFSISVNYGHHVQHFKVLRDTESNGKYYLWEAKFNSLNELVDYY 137

  Fly   523 QRAPI 527
            :|..|
 Frog   138 RRHSI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dockNP_001259845.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701 19/51 (37%)
SH2_Nck_family 446..538 CDD:198196 33/84 (39%)
grapNP_001332868.1 SH3_GRAP_N 2..55 CDD:212881 19/51 (37%)
SH2_Grb2_like 56..152 CDD:199828 35/102 (34%)
SH3_GRAP_C 161..213 CDD:212884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.