DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and RCCD1

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001017919.1 Gene:RCCD1 / 91433 HGNCID:30457 Length:376 Species:Homo sapiens


Alignment Length:440 Identity:101/440 - (22%)
Similarity:159/440 - (36%) Gaps:107/440 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EHRVYVW-GFQETGALGLQTNVKKAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFTVYAVNRDD 106
            |.|...| ||   |..|....:...:.|   .||.|:.|:  ...:|..|:|.:.:|.: |.|..
Human     3 EERPGAWFGF---GFCGFGQELGSGRGR---QVHSPSPLR--AGVDICRVSASWSYTAF-VTRGG 58

  Fly   107 GETLFGSGLNTDSQ---------LGFQVKGNPNDPANLDVIIYPTAIK---------LPRVQGET 153
            ...|.||......:         |...::..|...|.|.|....:|::         :|..:||.
Human    59 RLELSGSASGAAGRCKDAWASEGLLAVLRAGPGPEALLQVWAAESALRGEPLWAQNVVPEAEGED 123

  Fly   154 DEDMRVKSMSAGRAHLVVLTQNGTIFTLGNNSYGQCGRSIIEEERYSKSALIHRISQEDICGKED 218
            |.   .....|||..|:                 .|.|:.:     |..|..:|....::..:  
Human   124 DP---AGEAQAGRLPLL-----------------PCARAYV-----SPRAPFYRPLAPELRAR-- 161

  Fly   219 EVVQVECGQDHSMFLTKKGRIYTCGWGADGQTGQGNYHTAGQ---ITLIGGDVEKEKIVRLSCSS 280
               |:|.|.:|::.|...|::::.|.|..||.|.|......:   :..:.|.|..| :......|
Human   162 ---QLELGAEHALLLDAAGQVFSWGGGRHGQLGHGTLEAELEPRLLEALQGLVMAE-VAAGGWHS 222

  Fly   281 DCVLALNEAGDAFGWGNSEYGQ--LDDSELAETQINIPR-ALKLTKSIGKIKDVAAGGSFCMALN 342
            .||   :|.||.:.||.:|.||  |....|||....:.| |.:|.:...::|  ..||:      
Human   223 VCV---SETGDIYIWGWNESGQLALPTRNLAEDGETVAREATELNEDGSQVK--RTGGA------ 276

  Fly   343 DQGLVYTWGFGILGFGPFVEQTSKPQHLLPPLFGRNDFSNETTVVSIGCGVFHMGAVNSDGDLFM 407
            :.|..          .||:.....|..|        |....:..|...||..|...|...|:|:.
Human   277 EDGAP----------APFIAVQPFPALL--------DLPMGSDAVKASCGSRHTAVVTRTGELYT 323

  Fly   408 WGKNRFGHLGLGHKKDQFFPFKAAINGKVTKVAYGVDHTIAL----CKPF 453
            ||..::|.  |||:.....       .:..:|.|.||..:.:    |.|:
Human   324 WGWGKYGQ--LGHEDTTSL-------DRPRRVEYFVDKQLQVKAVTCGPW 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826 15/56 (27%)
RCC1_2 159..188 CDD:290274 4/28 (14%)
RCC1 175..233 CDD:278826 9/57 (16%)
RCC1_2 220..249 CDD:290274 8/28 (29%)
RCC1 236..286 CDD:278826 13/52 (25%)
RCC1 290..341 CDD:278826 17/53 (32%)
RCC1 345..395 CDD:278826 9/49 (18%)
RCC1_2 386..414 CDD:290274 9/27 (33%)
RCC1 402..449 CDD:278826 12/46 (26%)
RCCD1NP_001017919.1 Interaction with KDM8. /evidence=ECO:0000269|PubMed:24981860 1..169 43/204 (21%)
ATS1 <156..340 CDD:227511 55/220 (25%)
RCC1 2 176..227 13/54 (24%)
RCC1 3 229..317 28/113 (25%)
RCC1 4 318..371 14/56 (25%)
RCC1 319..366 CDD:395335 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.