DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and HERC3

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens


Alignment Length:332 Identity:93/332 - (28%)
Similarity:154/332 - (46%) Gaps:33/332 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 GFQVKGNPNDPANLDVIIYPTAIKLPRVQGETDEDMRVKSMSAGRAHLVVLTQNGTIFTLGNNSY 186
            |:...|.|....||..|:..     |:|.|.. .|..||.::.|..|.|.|.::|.::|.|.|:.
Human     5 GYWSLGQPGISTNLQGIVAE-----PQVCGFI-SDRSVKEVACGGNHSVFLLEDGEVYTCGLNTK 63

  Fly   187 GQCGRSIIEEERYSKSALIHRISQEDICGKEDEVVQVECGQDHSMFLTKKGRIYTCGWGADGQTG 251
            ||.|    .|...:|...|..::       :..::.|.||:.||:.|:.:|::::.|.|:|||.|
Human    64 GQLG----HEREGNKPEQIGALA-------DQHIIHVACGESHSLALSDRGQLFSWGAGSDGQLG 117

  Fly   252 QGNYHTAGQITLIGGDVEKEKIVRLSCSSDCVLALNEAGDAFGWGNSEYGQLDDSELAETQINIP 316
            ......:..:..:...:.::.|:::||.:...|||...|..|.||.:.:|||...:...:|.: |
Human   118 LMTTEDSVAVPRLIQKLNQQTILQVSCGNWHCLALAADGQFFTWGKNSHGQLGLGKEFPSQAS-P 181

  Fly   317 RALKLTKSIGKIKDVAAGGSFCMALNDQGLVYTWGF---GILGFGPFVEQTSKPQHLLPPLFGRN 378
            :.::..:.| .:..|||||:...||:..|.|:.||.   |.||.....::.| |.|:        
Human   182 QRVRSLEGI-PLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRES-PCHV-------- 236

  Fly   379 DFSNETTVVSIGCGVFHMGAVNSDGDLFMWGKNRFGHLGLGHKKDQFFPFKA--AINGKVTKVAY 441
            .......||.|.||..|...:...|.:|.:|....|.||.....|:..|.:.  .:..:||::|.
Human   237 KLLRTQKVVYISCGEEHTAVLTKSGGVFTFGAGSCGQLGHDSMNDEVNPRRVLELMGSEVTQIAC 301

  Fly   442 GVDHTIA 448
            |..||:|
Human   302 GRQHTLA 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274 10/28 (36%)
RCC1 175..233 CDD:278826 15/57 (26%)
RCC1_2 220..249 CDD:290274 10/28 (36%)
RCC1 236..286 CDD:278826 11/49 (22%)
RCC1 290..341 CDD:278826 15/50 (30%)
RCC1 345..395 CDD:278826 15/52 (29%)
RCC1_2 386..414 CDD:290274 9/27 (33%)
RCC1 402..449 CDD:278826 15/49 (31%)
HERC3NP_055421.1 RCC1 1 1..51 16/51 (31%)
ATS1 2..331 CDD:227511 93/332 (28%)
RCC1 2 52..101 16/59 (27%)
RCC1 3 102..154 13/51 (25%)
RCC1 4 156..207 17/52 (33%)
RCC1 5 208..259 16/59 (27%)
RCC1 6 261..311 15/48 (31%)
RCC1 313..377 CDD:366085
RCC1 7 313..366
HECTc 702..1048 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.