DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and PRAF1

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_565144.1 Gene:PRAF1 / 844030 AraportID:AT1G76950 Length:1103 Species:Arabidopsis thaliana


Alignment Length:533 Identity:117/533 - (21%)
Similarity:183/533 - (34%) Gaps:150/533 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GVLAQDKSK-IKEYSPKTTDSHEHRVYVWGFQETGA---LGLQTNVKKAKERYTEMVHHPTRLQF 82
            |.|:.|.|: :...||.::.:...|    |....|.   :...|:.|.|:..........:.:..
plant   139 GGLSVDASRELTSSSPSSSSASASR----GHSSPGTPFNIDPITSPKSAEPEVPPTDSEKSHVAL 199

  Fly    83 SNNNEITDVAAGYGFTVYAVNRDDGETLFGSGLNTDSQLGFQVKGNPNDPANLDVIIY------- 140
            .|.|..|.|:...||.| :|:.....:..||..:....||             ||.|:       
plant   200 DNKNMQTKVSGSDGFRV-SVSSAQSSSSHGSAADDSDALG-------------DVYIWGEVICDN 250

  Fly   141 ---------------PTAIKLPRVQGETDEDMRVKSMSAGRAHLVVLTQNGTIFTLGNNSYGQCG 190
                           .|.:.:|:.. |::..:.|..::.|..|...:|:.|.|||.|..|.|:.|
plant   251 VVKVGIDKNASYLTTRTDVLVPKPL-ESNIVLDVHQIACGVRHAAFVTRQGEIFTWGEESGGRLG 314

  Fly   191 RSI---------------------------------IEEERYSKSALIHRIS------------Q 210
            ..|                                 :..|.|:.....|.:.            .
plant   315 HGIGKDVFHPRLVESLTATSSVDFVACGEFHTCAVTLAGELYTWGDGTHNVGLLGHGSDISHWIP 379

  Fly   211 EDICGKED--EVVQVECGQDHSMFLTKKGRIYTCGWGADGQTGQGN------------------- 254
            :.|.|..:  .|..|.||..|:..:|..||::|.|.|..|..|.|:                   
plant   380 KRIAGSLEGLHVASVSCGPWHTALITSYGRLFTFGDGTFGVLGHGDKETVQYPREVESLSGLRTI 444

  Fly   255 ------YHTAGQITLIGGDVEKEKIVRLSCSSDCVLALNEAGDAFGWGNSEYGQL----DDSELA 309
                  :|||..:         |.||..|.||..     .:|..|.||:.:..:|    .|..|.
plant   445 AVSCGVWHTAAVV---------EIIVTQSNSSSV-----SSGKLFTWGDGDKNRLGHGDKDPRLK 495

  Fly   310 ETQINIPRALKLTKSIGKIKDVAAGGSFCMALNDQGLVYTWGFGILGFGPFVEQTSKPQHLLPPL 374
            .|  .:|..:..     ....:|.|.|..:.|...|.|:|.|..:.|....::...|    ||.|
plant   496 PT--CVPALIDY-----NFHKIACGHSLTVGLTTSGQVFTMGSTVYGQLGNLQTDGK----LPCL 549

  Fly   375 FGRNDFSNETTVVSIGCGVFHMGAVNSDGDLFMWGKNRFGHLGLGHKKDQFFP--FKAAINGKVT 437
            .  .|......|..|.||.:|:.|:.|..:::.|||...|.||.|..:|:..|  .:|..:..|.
plant   550 V--EDKLASEFVEEISCGAYHVAALTSRNEVYTWGKGANGRLGHGDLEDRKVPTIVEALKDRHVK 612

  Fly   438 KVAYGVDHTIALC 450
            .:|.|.::|.|:|
plant   613 YIACGSNYTAAIC 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826 12/58 (21%)
RCC1_2 159..188 CDD:290274 10/28 (36%)
RCC1 175..233 CDD:278826 19/104 (18%)
RCC1_2 220..249 CDD:290274 11/28 (39%)
RCC1 236..286 CDD:278826 17/74 (23%)
RCC1 290..341 CDD:278826 12/54 (22%)
RCC1 345..395 CDD:278826 14/49 (29%)
RCC1_2 386..414 CDD:290274 10/27 (37%)
RCC1 402..449 CDD:278826 14/48 (29%)
PRAF1NP_565144.1 PH_PLC_plant-like 14..124 CDD:270171
ATS1 238..628 CDD:227511 94/429 (22%)
FYVE 627..695 CDD:214499
COG1340 <828..909 CDD:224259
BRX_N 879..>908 CDD:404581
BRX 1022..1077 CDD:400608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.