DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and EEA1

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_011537116.1 Gene:EEA1 / 8411 HGNCID:3185 Length:1453 Species:Homo sapiens


Alignment Length:350 Identity:66/350 - (18%)
Similarity:120/350 - (34%) Gaps:106/350 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ISRSYTAKAKRGVLAQDKSKIKEYSPKTTDSHEHRVYVWGFQETGALGLQTNVKKAKERYTEMVH 75
            :.|.:...:::|...|   |:||...:....::|              |:...|:.:::..|...
Human   402 LHRIHVELSEKGEATQ---KLKEELSEVETKYQH--------------LKAEFKQLQQQREEKEQ 449

  Fly    76 HPTRLQFSNNNEITDVAAGYGFTVYAVNRDDGETLFGSGLNTDSQLGFQVKGNPNDPANL----- 135
            |..:||...|.                       |....|.|:.||| :..|...:...|     
Human   450 HGLQLQSEINQ-----------------------LHSKLLETERQLG-EAHGRLKEQRQLSSEKL 490

  Fly   136 ---DVIIYPTAIKLPRVQGETDEDMRVKSMSAGRAHLVVLT----------QNGTIFTL--GNNS 185
               :..:....:||.|::.:..|.:   :.|....|.:..|          |..|...|  ..|.
Human   491 MDKEQQVADLQLKLSRLEEQLKEKV---TNSTELQHQLDKTKQQHQEQQALQQSTTAKLREAQND 552

  Fly   186 YGQCGRSIIEEER--YSKSALIHRISQEDIC----GKEDEVVQVECGQ------------DHSM- 231
            ..|..|.|.::::  .:..||:.: |:|:|.    .:||...:::.|:            :|:: 
Human   553 LEQVLRQIGDKDQKIQNLEALLQK-SKENISLLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQ 616

  Fly   232 ----FLTKKGRIYTCGWGADGQTGQGNYHTAGQITLIGGDVEKEKIVRLSCSSDCVLAL----NE 288
                .||:|.:            .|...|...|..|  .|..:|:...|..:.|.||:|    ||
Human   617 EQVTQLTEKLK------------NQSESHKQAQENL--HDQVQEQKAHLRAAQDRVLSLETSVNE 667

  Fly   289 AGDAFGWGNSEYGQLDDSELAETQI 313
            ..........:..|||....|:|::
Human   668 LNSQLNESKEKVSQLDIQIKAKTEL 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826 8/55 (15%)
RCC1_2 159..188 CDD:290274 7/40 (18%)
RCC1 175..233 CDD:278826 15/82 (18%)
RCC1_2 220..249 CDD:290274 5/45 (11%)
RCC1 236..286 CDD:278826 11/49 (22%)
RCC1 290..341 CDD:278826 5/23 (22%)
RCC1 345..395 CDD:278826
RCC1_2 386..414 CDD:290274
RCC1 402..449 CDD:278826
EEA1XP_011537116.1 Myosin_tail_1 308..1382 CDD:279860 66/349 (19%)
DUF342 <425..519 CDD:302792 20/134 (15%)
FYVE_EEA1 1389..1451 CDD:277269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.