DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and HECTD3

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_078878.3 Gene:HECTD3 / 79654 HGNCID:26117 Length:861 Species:Homo sapiens


Alignment Length:171 Identity:40/171 - (23%)
Similarity:64/171 - (37%) Gaps:56/171 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TTDSH--EHRVYVWGFQETGALGLQTNVKKAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFTVY 100
            |||.:  ..||.|:|       |...|:||..:...:            ...|.||......||:
Human   300 TTDDNFMPKRVVVYG-------GEGDNLKKLSDVSID------------ETLIGDVCVLEDMTVH 345

  Fly   101 --------AVNRDDGETLFGSGLNTDSQL-GFQVKGNPNDPANLDVIIY-PTA-IKLPRVQGETD 154
                    ...||||         .|.:| |.::|.:......|:..:: ||: ::.||::| ||
Human   346 LPIIEIRIVECRDDG---------IDVRLRGVKIKSSRQRELGLNADLFQPTSLVRYPRLEG-TD 400

  Fly   155 EDMR----------VKSMSAGRAHLVVLTQNGTIFTLGNNS 185
            .::.          :|.:.:...|||....:    |||..|
Human   401 PEVLYRRAVLLQRFIKILDSVLHHLVPAWDH----TLGTFS 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826 11/55 (20%)
RCC1_2 159..188 CDD:290274 8/27 (30%)
RCC1 175..233 CDD:278826 4/11 (36%)
RCC1_2 220..249 CDD:290274
RCC1 236..286 CDD:278826
RCC1 290..341 CDD:278826
RCC1 345..395 CDD:278826
RCC1_2 386..414 CDD:290274
RCC1 402..449 CDD:278826
HECTD3NP_078878.3 APC10-HECTD3 238..371 CDD:176487 23/98 (23%)
HECT 579..845 CDD:366212
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.