DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and sergef

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001072233.1 Gene:sergef / 779680 XenbaseID:XB-GENE-6455308 Length:349 Species:Xenopus tropicalis


Alignment Length:332 Identity:86/332 - (25%)
Similarity:136/332 - (40%) Gaps:70/332 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 ETLFGSGLNTDSQLGFQVKGNPNDPANLDVIIYPTAIKLPRVQGETDEDMRVKSMSAGRAHLVVL 172
            :.|:..|.|:..|||.   |:..|.....::|           |..:.:..::|:|||..|...:
 Frog     9 QLLYAWGANSYGQLGV---GSTQDTPVPQLVI-----------GLPNHETVIRSISAGGGHSAAV 59

  Fly   173 TQNGTIFTLGNNSYGQCGRSIIEEERYSKSALIHRISQEDIC------GKEDEVVQVECGQDHSM 231
            |::|.::..|.||.||.|             |.|.......|      |.  .|.:|.||.|.::
 Frog    60 TESGRVYVCGQNSEGQLG-------------LDHTTDVTQFCLCPGALGL--RVSKVSCGWDFTL 109

  Fly   232 FLTKKGRIYTCGWGADGQTGQGNYHTAGQITL---IGGDVEKEKIVRLSCSSDCVLALNEAGDAF 293
            .|.:.|.:.:||.....|.|:..   ||:..:   :|  ::|.|::.::.....||||.:.|..|
 Frog   110 ILAETGELLSCGANTYSQLGRAG---AGRSCVPRPVG--IQKRKVIDVAAGLRHVLALTDNGQIF 169

  Fly   294 GWGNSEYGQLDDSELAETQINIPRALKLTKS---------IGKIKDVAAGGSFCMALNDQGLVYT 349
            .||:   |....:.....|..||.....|:.         .||:  |.||...|:||:|.|.:|.
 Frog   170 QWGS---GLASHARRFSPQNPIPPVYGATEPCPVPGMEGICGKV--VTAGSYHCVALSDAGDMYA 229

  Fly   350 WGFG----ILGFGPFVEQTSKPQHLLPPLFGRNDFSNETTVVSIGCGVFHMGAVNSDGDLFMWGK 410
            ||..    :|...||         ||.|...:..|....::|::..|..|:.|....|.:|.||:
 Frog   230 WGSNKHGQLLHPDPF---------LLHPHRVQAHFFLGESIVAVTSGWTHLVAQTDTGKVFTWGR 285

  Fly   411 NRFGHLG 417
            ..:..||
 Frog   286 ANYSQLG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274 10/28 (36%)
RCC1 175..233 CDD:278826 16/63 (25%)
RCC1_2 220..249 CDD:290274 9/28 (32%)
RCC1 236..286 CDD:278826 12/52 (23%)
RCC1 290..341 CDD:278826 15/59 (25%)
RCC1 345..395 CDD:278826 13/53 (25%)
RCC1_2 386..414 CDD:290274 8/27 (30%)
RCC1 402..449 CDD:278826 6/16 (38%)
sergefNP_001072233.1 RCC1 11..>294 CDD:332518 86/330 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.