DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and HERC6

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_005263140.1 Gene:HERC6 / 55008 HGNCID:26072 Length:1034 Species:Homo sapiens


Alignment Length:307 Identity:90/307 - (29%)
Similarity:144/307 - (46%) Gaps:43/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 SAGRAHLVVLTQNGTIFTLGNNSYGQCGRSIIEEERYSKSALIH----RISQEDICGKEDEVVQ- 222
            ::|..|.::|..|..:.:.|:||.||.||.  ..:|.....::.    ...:|.|...|..:|. 
Human    29 ASGERHSLLLLTNHRVLSCGDNSRGQLGRR--GAQRGELPVVVGGCFVLFPKEPIQALETLIVDL 91

  Fly   223 VECGQDHSMFLTKKGRIYTCGWGADGQTGQGNY----HTAGQITLIGGDVEKEKIVRLSCSSDCV 283
            |.||::||:.:..|||::..|.|::||.|.|.:    .|..:|..: .|:   ||:::||.....
Human    92 VSCGKEHSLAVCHKGRVFAWGAGSEGQLGIGEFKEISFTPKKIMTL-NDI---KIIQVSCGHYHS 152

  Fly   284 LALNEAGDAFGWGNSEYGQLDDSELAETQINIPRALKLTKSIGKIKDVAAGGSFCMALNDQGLVY 348
            |||::....|.||.:.:|||...:...:|.: |:.::..:.| .:..|||||:...||:..|..:
Human   153 LAL
SKDSQVFSWGKNSHGQLGLGKEFPSQAS-PQRVRSLEGI-PLAQVAAGGAHSFALSLCGTSF 215

  Fly   349 TWGFGILGFGPFVEQTSKPQHLLPPLFGRN--DFSNETT---------VVSIGCGVFHMGAVNSD 402
            .||....|      |.:        |.|||  ..||:..         ||.|.||..|...:..|
Human   216 GWGSNSAG------QLA--------LSGRNVPVQSNKPLSVGALKNLGVVYISCGDAHTAVLTQD 266

  Fly   403 GDLFMWGKNRFGHLGLGHKKDQFFP-FKAAINGKVTKVAYGVDHTIA 448
            |.:|.:|.||.|.||.....::..| ....|:|.|:::..|..||:|
Human   267 GKVFTFGDNRSGQLGYSPTPEKRGPQLVERIDGLVSQIDCGSYHTLA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274 7/24 (29%)
RCC1 175..233 CDD:278826 18/62 (29%)
RCC1_2 220..249 CDD:290274 11/29 (38%)
RCC1 236..286 CDD:278826 17/53 (32%)
RCC1 290..341 CDD:278826 14/50 (28%)
RCC1 345..395 CDD:278826 16/60 (27%)
RCC1_2 386..414 CDD:290274 12/27 (44%)
RCC1 402..449 CDD:278826 17/48 (35%)
HERC6XP_005263140.1 RCC1_2 27..54 CDD:290274 7/24 (29%)
RCC1_2 89..118 CDD:290274 11/28 (39%)
RCC1 105..155 CDD:278826 17/53 (32%)
RCC1 158..208 CDD:278826 14/51 (27%)
RCC1 215..263 CDD:278826 16/61 (26%)
RCC1_2 250..279 CDD:290274 12/28 (43%)
RCC1 266..313 CDD:278826 16/46 (35%)
HECTc 684..1026 CDD:238033
HECTc 711..1026 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.