DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and niki

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster


Alignment Length:343 Identity:82/343 - (23%)
Similarity:130/343 - (37%) Gaps:97/343 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KRGVLAQDKSKIKEYS-------PKT-------TDSH------EHRVYVWGFQETGALGLQTNVK 64
            ||.||.|.|:....:|       ||.       :|||      :...|.||....|.|||     
  Fly   427 KRSVLYQLKAFGTCFSMAPIQLPPKAVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGL----- 486

  Fly    65 KAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFTVYAVNRDDGETLFGSGLNTDSQLGFQVKGNP 129
            .|.|.:.   |:|:|::...|..:....||.|||:...   ...:|...|.|....||...:.|.
  Fly   487 TALEAWK---HYPSRMESVRNYHVVSACAGDGFTILVT---QAGSLLSCGSNAHLALGQDEQRNY 545

  Fly   130 NDP---ANLDVIIYPTAIKLPRVQGETDEDMRVKSMSAGRAHLVVLTQNGTIFTLGNNSYGQCGR 191
            :.|   |.|                   .|:||:.::||..|::.|::.|.::..|.::.|..|.
  Fly   546 HSPKLIARL-------------------ADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGL 591

  Fly   192 SIIEEE--------------RYSK-------SALIHRISQEDICGKED----------------- 218
            ...:::              :.||       ||::....:..:||..|                 
  Fly   592 GNYQQQQKFPQKILLSHVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQRSAKITAFKK 656

  Fly   219 -----EVVQVECGQDHSMFLTKKGRIYTCGWGADGQTGQGNYHTAGQITLIGGDVEKEKIVRLSC 278
                 :|.|......||:||.:.|.:||.|..|:||.|..:.::....||: ..|:...||:.:|
  Fly   657 VQLPHKVTQACFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCNSVDHPTLV-DSVKSRYIVKANC 720

  Fly   279 SSDCVLALNEAGDAFGWG 296
            |..|.:..:|......||
  Fly   721 SDQCTIVASEDNIITVWG 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826 17/55 (31%)
RCC1_2 159..188 CDD:290274 7/28 (25%)
RCC1 175..233 CDD:278826 15/100 (15%)
RCC1_2 220..249 CDD:290274 11/28 (39%)
RCC1 236..286 CDD:278826 16/49 (33%)
RCC1 290..341 CDD:278826 2/7 (29%)
RCC1 345..395 CDD:278826
RCC1_2 386..414 CDD:290274
RCC1 402..449 CDD:278826
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 75/325 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.