DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and Als2

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster


Alignment Length:313 Identity:71/313 - (22%)
Similarity:113/313 - (36%) Gaps:85/313 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VYVWGFQETGALGLQTNVKKAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFTVYAVNRDDGETL 110
            |:|....||..:|....|.||:::...|     || :....|:.|:|||....|..|        
  Fly   150 VFVGASGETYVMGSCGEVFKAEQQPRHM-----RL-YEEGKELLDLAAGNEHFVMLV-------- 200

  Fly   111 FGSGLN-TDSQLGFQVKGNPNDPANLDVIIYPTAIKLPRVQGETDEDMRVKSMSAGRA------- 167
              :..| .|..|...|.....:|                    .||...|||:|:|.:       
  Fly   201 --APYNLADDALQLSVASAKEEP--------------------EDERASVKSISSGHSERSVAAN 243

  Fly   168 --HL------VVLTQNGTIFTLGNNSYGQCGRSIIEEERYSKSALIHRISQEDICGKEDEVVQVE 224
              ||      ::.||   :||.|.::.|..|..     .:.:.|.:.|:.:.|..|    |..:.
  Fly   244 TRHLLHQGYALLHTQ---LFTFGASNNGLLGSG-----DHIRRANVMRLQKLDSMG----VCSIA 296

  Fly   225 CGQDHSMFLTKKGRIYTCGWGADGQTGQGNYHTAGQITLIGG----DVEKEKIVRLSCSSDCVLA 285
            .|.:|::..|..||:|..|.....|.|: :..:..:||:...    .:|:...:..:|.....|.
  Fly   297 AGLEHTVARTLDGRLYHWGLNNHSQLGE-DVSSPMEITITENTAALPIEQNSALEATCGDYHTLL 360

  Fly   286 LNEAGDAFG----------WGNSEYGQLDDSELAETQINI--PRALKLTKSIG 326
            ||.:|....          ..:|.|.|    .|.:.|:..  ||.|:|....|
  Fly   361 LNASGQIHSLQPAPPMRHLQQSSTYAQ----TLLQLQLGAAWPRQLRLLMCSG 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826 16/52 (31%)
RCC1_2 159..188 CDD:290274 12/43 (28%)
RCC1 175..233 CDD:278826 12/57 (21%)
RCC1_2 220..249 CDD:290274 8/28 (29%)
RCC1 236..286 CDD:278826 11/53 (21%)
RCC1 290..341 CDD:278826 11/49 (22%)
RCC1 345..395 CDD:278826
RCC1_2 386..414 CDD:290274
RCC1 402..449 CDD:278826
Als2NP_649347.1 RCC1 258..304 CDD:278826 13/57 (23%)
RCC1_2 292..321 CDD:290274 8/28 (29%)
RCC1 308..361 CDD:278826 11/53 (21%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.