DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and CG8060

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster


Alignment Length:388 Identity:75/388 - (19%)
Similarity:128/388 - (32%) Gaps:143/388 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GLNTDSQLGFQVKGNPNDPANLDVIIYPTAIKLPRVQGETDEDMRVKSMSAGRAHLVVLTQNGTI 178
            |.|.:..||...:.|.|.|..:|..              ...::.::.::.|..|.:...:.|.:
  Fly   152 GSNKNYNLGIGNEQNTNTPQAVDFF--------------RKSNLWLEQVALGAYHSLFCDKKGHL 202

  Fly   179 FTLGNNSYGQCG----RSIIEEERYSKSALIHRISQEDICGKEDEVVQVECGQDHSMFLTKKGRI 239
            :.:|:...|:.|    .|:...:|...|:.:          ..|.:..:...:.||:.||.:..:
  Fly   203 YAVGHGKGGRLGIGLENSLPAPKRVKVSSKL----------SGDSIQCISVSRQHSLVLTHQSLV 257

  Fly   240 YTCGWGADGQTGQGNYHTAGQITLIGGDVEKEKI-VRLSCSSDC--VLALNEAGDAFG------W 295
            :.||...|.|.|..:  .|.|:|..     ||.: :|...:||.  |:|.::...|:|      |
  Fly   258 FACGLNTDHQLGVRD--AAEQLTQF-----KEVVALRDKGASDLVRVIACDQHSIAYGSRCVYVW 315

  Fly   296 GNSEYGQLDDSELAETQINIPRALKL--------------------------------------- 321
            |.:: ||...:....: |.:|..:||                                       
  Fly   316 GANQ-GQFGINSNTPS-ITVPTLIKLPAKTTIRFVEANNAATVIYNEEKIITLCYADKTRYIKTP 378

  Fly   322 ----TKSI----GKIKDVAAGGSFC---MALNDQGLVYTWGFGILGFGPFVEQTSKPQHLLPPLF 375
                .|||    |.:|:...|.:..   :.|.:..:||.|          .|.|.:        |
  Fly   379 NYEDLKSISVMGGNLKNSTKGSAAALKLLMLTETNVVYLW----------YENTQQ--------F 425

  Fly   376 GRNDFS--------------NETTVVS-IGCGVFHMGAVN------------SDGDLFMWGKN 411
            .|.:||              |:..|:| .||  .:.|..|            |.|.|..|..|
  Fly   426 YRCNFSPIRLHQIKKILYKCNQVMVLSEDGC--VYRGKCNQIALPSSALQEKSRGSLDNWQDN 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274 4/28 (14%)
RCC1 175..233 CDD:278826 10/61 (16%)
RCC1_2 220..249 CDD:290274 7/28 (25%)
RCC1 236..286 CDD:278826 14/52 (27%)
RCC1 290..341 CDD:278826 16/106 (15%)
RCC1 345..395 CDD:278826 14/64 (22%)
RCC1_2 386..414 CDD:290274 11/39 (28%)
RCC1 402..449 CDD:278826 4/10 (40%)
CG8060NP_611117.2 ANK <46..138 CDD:238125
ANK repeat 56..87 CDD:293786
Ank_4 57..111 CDD:290365
ANK repeat 89..121 CDD:293786
Ank_2 95..>138 CDD:289560
RCC1 147..195 CDD:278826 10/56 (18%)
RCC1 199..251 CDD:278826 10/61 (16%)
BTB 547..>635 CDD:295341
BTB 684..795 CDD:279045
BTB 697..798 CDD:197585
SPOP_C_like 798..>834 CDD:269810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.