DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and Sergef

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_038956885.1 Gene:Sergef / 365243 RGDID:1563497 Length:481 Species:Rattus norvegicus


Alignment Length:291 Identity:78/291 - (26%)
Similarity:120/291 - (41%) Gaps:48/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 IFTLGNNSYGQCGRSIIEEERYSKSALIHRISQEDICGKEDEVVQVECGQDHSMFLTKKGRIYTC 242
            :|..|.|||||.|..      :.:..|:.: ...|.| |...:..|..|..||:.:|..|.::.|
  Rat    17 LFAWGANSYGQLGLG------HKEDVLLPQ-QLSDFC-KSGCIKSVTGGGGHSVVVTDGGGLFVC 73

  Fly   243 GWGADGQTGQGNYHTAGQIT----LIGGDVEKEKIVRLSCSSDCVLALNEAGDAFGWGNSEYGQL 303
            |...|||.|.|:.....:.|    |:|..:.     :::|..|..:.|.|.|.....|::.:|||
  Rat    74 GLNKDGQLGLGHTEEVLRFTICKPLLGCPIR-----QVACGWDFTIMLTEKGQVLSCGSNAFGQL 133

  Fly   304 DDSELAETQINIPRALKLTKSIGKIKDVAAGGSFCMALNDQGLVYTWGFGILGFGPFVEQTSKPQ 368
            .... ...:..:|:|::..:.  |:..||||....:|..|.|..:.||.|:...|         :
  Rat   134 GVPH-GPRKCVVPQAIECLRE--KVVCVAAGLRHALATTDTGSTFQWGTGLASSG---------R 186

  Fly   369 HLLP----PLF------GRNDFSNETTVVSIGCGVFHMGAVNSDGDLFMWGKNRFGHLGLGHKKD 423
            .|.|    |||      .|......:|||....|..|..::...|:|::||:|:.|.|.   ...
  Rat   187 RLCPGQNLPLFLTAKEPSRVTGLESSTVVCAVAGSDHSASLTDTGELYVWGRNKHGQLA---SLA 248

  Fly   424 QFFPFKAAING------KVTKVAYGVDHTIA 448
            .|.|....:..      |||.|..|..|.:|
  Rat   249 TFLPLPQRVEAHYFQDEKVTAVWSGWTHLVA 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274 5/9 (56%)
RCC1 175..233 CDD:278826 16/54 (30%)
RCC1_2 220..249 CDD:290274 9/28 (32%)
RCC1 236..286 CDD:278826 13/53 (25%)
RCC1 290..341 CDD:278826 12/50 (24%)
RCC1 345..395 CDD:278826 15/59 (25%)
RCC1_2 386..414 CDD:290274 9/27 (33%)
RCC1 402..449 CDD:278826 16/53 (30%)
SergefXP_038956885.1 ATS1 17..>325 CDD:227511 78/291 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.