DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and tag-229

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001021670.1 Gene:tag-229 / 3565487 WormBaseID:WBGene00044065 Length:200 Species:Caenorhabditis elegans


Alignment Length:156 Identity:28/156 - (17%)
Similarity:50/156 - (32%) Gaps:63/156 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 DGQTGQGNY--HTAGQITLIGGDVEKEKIVRLSCSSDCVLALNEAGDAFGWGNSEYGQLDDSELA 309
            :|..|.|.|  |.|..:....|||...            ..||..|...||        |:..:|
 Worm    74 NGAYGMGQYTRHRAPHVEFRVGDVITH------------TKLNFRGVIIGW--------DEHAIA 118

  Fly   310 ETQINIPRALKLTKSIGKIKDVAAGGSFCMALN-------------------DQGLVYTWGFGIL 355
            ..:.     ||:..  |:.|:.|...::.:.::                   |:|.|        
 Worm   119 PEKF-----LKVAH--GENKNYATQPNYAVLIDTRDRLTPQLSYIVQENLEIDKGTV-------- 168

  Fly   356 GFGPFVEQ------TSKPQHLLPPLF 375
             ..|.|::      ..:.::::.||:
 Worm   169 -MHPLVDKFFDGFDEKRQKYIMRPLY 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274
RCC1 175..233 CDD:278826
RCC1_2 220..249 CDD:290274 0/1 (0%)
RCC1 236..286 CDD:278826 9/40 (23%)
RCC1 290..341 CDD:278826 10/50 (20%)
RCC1 345..395 CDD:278826 6/37 (16%)
RCC1_2 386..414 CDD:290274
RCC1 402..449 CDD:278826
tag-229NP_001021670.1 YccV-like 89..186 CDD:382598 20/132 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.