DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and Nek2

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster


Alignment Length:184 Identity:31/184 - (16%)
Similarity:55/184 - (29%) Gaps:77/184 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 GDAFGWGNSEYGQLDDS--ELAETQINIPRAL--------------KLTKSIGKIKDVAAGG--- 335
            |:.|.|....|.:||::  :...::|::.|.|              :..||:..:.:..|||   
  Fly    42 GELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLA 106

  Fly   336 -----------------------SFCMA------------------------LNDQGLVYTWGFG 353
                                   ..|.|                        |:..|......||
  Fly   107 QIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFG 171

  Fly   354 ILGF--------GPFVEQTSKPQHLLPPLFGRNDFSNETTVVSIGCGVFHMGAV 399
            :...        ..||   ..|.::.|.|.....:..::.|.::||.|:.|.|:
  Fly   172 LARMLRRDQSFAASFV---GTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCAL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274
RCC1 175..233 CDD:278826
RCC1_2 220..249 CDD:290274
RCC1 236..286 CDD:278826
RCC1 290..341 CDD:278826 16/116 (14%)
RCC1 345..395 CDD:278826 12/57 (21%)
RCC1_2 386..414 CDD:290274 6/14 (43%)
RCC1 402..449 CDD:278826
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 31/184 (17%)
S_TKc 19..281 CDD:214567 31/184 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.