DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and Rccd1

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_006229517.1 Gene:Rccd1 / 308760 RGDID:1309901 Length:378 Species:Rattus norvegicus


Alignment Length:394 Identity:75/394 - (19%)
Similarity:129/394 - (32%) Gaps:146/394 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 QNGTIFTLGNNSYGQC-----GRSIIEEERYSKSALIHRISQEDICGKEDEVVQVECGQDHSMFL 233
            :.|..|..|...:||.     |:              |.:...:.....|:|.||.....::..:
  Rat     5 RQGAWFGFGFCGFGQALGSGNGQ--------------HAVHSPEPLHAADDVCQVSASWSYTALV 55

  Fly   234 TKKGRIYTCG------------WGADG-------QTGQGNYHTAGQITLIGGDVEKE-------- 271
            |:.||:...|            |.::|       ::|.|   |..|..:.|..::.|        
  Rat    56 TRGGRVELSGSVSCAADGCRDVWASEGLLVVQRNKSGSG---TELQAWVPGSALQGEPLWVQNLA 117

  Fly   272 --------------------------------------------KIVRLSCSSDCVLALNEAGDA 292
                                                        ::.:|...::..|.|.|||..
  Rat   118 SGAKAQGEDEPGSEPRMGTLPLLPCARAYMTPQPPFCQPLAPELRVRQLQLGAEHALLLCEAGQV 182

  Fly   293 FGWGNSEYGQLDDSELAETQINIPRALKLTKSIGKIKDVAAGGSFCMALNDQGLVYTWGF----- 352
            |.||...:|||....| |.::. ||.|:..:.: ::.:|||||...:.:::.|.:|.||:     
  Rat   183 FSWGGGRHGQLGHGSL-EAELE-PRLLEALQGL-RMAEVAAGGWHSVCVSETGDIYIWGWNESGQ 244

  Fly   353 ------------------------GILGFGPFVEQTSKPQHLL-----PPLFGRNDFSNETTVVS 388
                                    |:.|....:.....|.|.:     |.|.   |....:..|.
  Rat   245 LALPTRSGTEKKTVREEATELNDDGLRGEEAALADVGAPAHFIAIQPFPALL---DLPLGSDAVK 306

  Fly   389 IGCGVFHMGAVNSDGDLFMWGKNRFGHLGLGHKKDQFFPFKAAINGKVTKVAYGVDHTIAL---- 449
            ..||..|...|...|:|:.||..::|.  ||||       .:..:.:..:|.|.|:..:.:    
  Rat   307 ASCGSRHTAVVTRTGELYTWGWGKYGQ--LGHK-------DSTSSDQPCRVEYFVERQLEVRAVT 362

  Fly   450 CKPF 453
            |.|:
  Rat   363 CGPW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274 3/13 (23%)
RCC1 175..233 CDD:278826 11/62 (18%)
RCC1_2 220..249 CDD:290274 9/47 (19%)
RCC1 236..286 CDD:278826 13/120 (11%)
RCC1 290..341 CDD:278826 17/50 (34%)
RCC1 345..395 CDD:278826 14/83 (17%)
RCC1_2 386..414 CDD:290274 9/27 (33%)
RCC1 402..449 CDD:278826 12/46 (26%)
Rccd1XP_006229517.1 RCC1_2 163..192 CDD:290274 9/28 (32%)
RCC1 180..228 CDD:278826 17/50 (34%)
RCC1_2 218..244 CDD:290274 9/25 (36%)
RCC1_2 305..333 CDD:290274 9/27 (33%)
RCC1 321..368 CDD:278826 14/55 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.