DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and HECTD4

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001103132.4 Gene:HECTD4 / 283450 HGNCID:26611 Length:4428 Species:Homo sapiens


Alignment Length:248 Identity:53/248 - (21%)
Similarity:87/248 - (35%) Gaps:78/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 YTEMVHHP-TRLQFSNNNEITDV-----AAG-YGFTVYAVNRDDGETLFGSGL-----------N 116
            |.:|:..| :....|:.|:..|:     |.| |.:|..:|.|  |.:..||||           |
Human   287 YEDMLPAPDSNTGSSSENKDADLGRCLTADGLYLYTTNSVGR--GVSKLGSGLHGTLRGFVYCRN 349

  Fly   117 TDSQLGFQVKGN----------PNDPANLDVIIYPTAIKLPRVQ---------GETDEDMRVKS- 161
            .:.:.|:...|:          .|.|.:|..:|....:::.:|.         |.|...:.:.| 
Human   350 EELEPGWVAFGSGSLLHRPVSFDNKPHSLFQVIDQNTLQVCQVVPMPANHLPIGSTMSTVHLSSD 414

  Fly   162 --------------MSAGRAHLV------VLTQNGTIF-------TLGNNSYGQCGRSI------ 193
                          ....:.|.|      ::.:||...       |:.....|:..:||      
Human   415 GTYFYWIWSPASLNEKTPKGHSVFMDIFELVVENGVFVANPLQERTILMRKEGESAKSINEMLLS 479

  Fly   194 -IEEERYSKSALIHRISQEDICG--KEDEVVQVECGQDHSMFLTKKGRIYTCG 243
             :...|.|.||.:..::...|..  |||:.....||....|.  :|..|||||
Human   480 RLSRYRASPSATLAALTGSTISNTLKEDQAANTSCGLPLKML--RKTPIYTCG 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826 9/35 (26%)
RCC1_2 159..188 CDD:290274 6/56 (11%)
RCC1 175..233 CDD:278826 17/73 (23%)
RCC1_2 220..249 CDD:290274 9/24 (38%)
RCC1 236..286 CDD:278826 6/8 (75%)
RCC1 290..341 CDD:278826
RCC1 345..395 CDD:278826
RCC1_2 386..414 CDD:290274
RCC1 402..449 CDD:278826
HECTD4NP_001103132.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.