DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and HERC4

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_011537894.1 Gene:HERC4 / 26091 HGNCID:24521 Length:1081 Species:Homo sapiens


Alignment Length:351 Identity:92/351 - (26%)
Similarity:140/351 - (39%) Gaps:86/351 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 GETDEDM-------------RVKSMSAGRAHLVVLTQNGTIFTLGNNSYGQCGRSIIEEERYSKS 202
            |..||::             ||:.:..|..|.|.:..:||::|.|.|..||.|.   |:.|....
Human    15 GGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGH---EKSRKKPE 76

  Fly   203 ALIHRISQEDICGKEDEVVQVECGQDHSMFLTKKGRIYTCGWGADGQTGQGNYHTAGQITLIGGD 267
            .::...:|        .:|.|.||:.|::.|..||::|..|..:|||.|           |:|.:
Human    77 QVVALDAQ--------NIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLG-----------LVGSE 122

  Fly   268 -----------------------------------VEKEKIVRLSCSSDCVLALNEAGDAFGWGN 297
                                               :...:||:::|.....|||::|.:.|.||.
Human   123 ECIRVPSCFPKIMCVDSLVRICSGLSYGRIRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQ 187

  Fly   298 SEYGQLDDSELAETQINIPRALKLTKSIGKIKDVAAGGSFCMALNDQGLVYTWG---FGILGFGP 359
            ::||||......:.|.: |:.||....| ....|||||:....|...|.::.||   ||.||...
Human   188 NKYGQLGLGTDCKKQTS-PQLLKSLLGI-PFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLND 250

  Fly   360 FVEQTSKPQHLLPPLFGRNDFSNETTVVSIGCGVFHMGAVNSDGDLFMWGKNRFGHLGLGHKKDQ 424
              |......:||..|       ....:|.|.||..|..|:..:|.:|.:|...:|.||......:
Human   251 --ENDRYVPNLLKSL-------RSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHE 306

  Fly   425 FFPFKA--AINGKVTKVAYGVDHTIA 448
            ..|.|.  .:...||::|.|..||.|
Human   307 INPRKVFELMGSIVTEIACGRQHTSA 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274 9/28 (32%)
RCC1 175..233 CDD:278826 16/57 (28%)
RCC1_2 220..249 CDD:290274 11/28 (39%)
RCC1 236..286 CDD:278826 14/84 (17%)
RCC1 290..341 CDD:278826 17/50 (34%)
RCC1 345..395 CDD:278826 15/52 (29%)
RCC1_2 386..414 CDD:290274 9/27 (33%)
RCC1 402..449 CDD:278826 15/49 (31%)
HERC4XP_011537894.1 RCC1 2..368 CDD:332518 92/351 (26%)
HECTc 733..1079 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.