DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and Eea1

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_006513585.1 Gene:Eea1 / 216238 MGIID:2442192 Length:1458 Species:Mus musculus


Alignment Length:260 Identity:50/260 - (19%)
Similarity:93/260 - (35%) Gaps:81/260 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTRGIVLG------ISRSYTAKAKRGVLAQDKSKIKEYSPKTTDS-------------------- 41
            ||:...||      ::.....||::..|..:.|..||...|.:||                    
Mouse   871 KTQHKELGDRMQAAVTELTAVKAQKDALLAELSTTKEKLSKVSDSLKNSKSEFEKENQKGKAAVL 935

  Fly    42 --------HEHRVYVWGFQETGALGLQTNVKKAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFT 98
                    .:|::.|   |...||..|.::||:.|:..|.   ..:|:...|:...:|:.... |
Mouse   936 DLEKACKELKHQLQV---QAESALKEQEDLKKSLEKEKET---SQQLKIELNSVKGEVSQAQN-T 993

  Fly    99 VYAVNRDDGETLFGSGLNTDSQLGFQVKGNPNDPANLDVIIYPTAIKLPRVQGETDEDMRVKSM- 162
            :....:|: :.|.|: :|...|...|.|.                 ::..:|||....:..|:: 
Mouse   994 LKQKEKDE-QQLQGT-INQLKQSAEQKKK-----------------QIEALQGEVKNAVSQKTVL 1039

  Fly   163 ------SAGRAHLVVLTQNGTIFTLGNNSYGQCGRSIIEEERYSKSALIHRISQEDICGKEDEVV 221
                  .:.:|...:..:.|.:..|.:| |.:|...:             :..|.|:.|||.|::
Mouse  1040 ENKLQQQSSQAAQELAAEKGKLSALQSN-YEKCQADL-------------KQLQSDLYGKESELL 1090

  Fly   222  221
            Mouse  1091  1090

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826 13/55 (24%)
RCC1_2 159..188 CDD:290274 6/35 (17%)
RCC1 175..233 CDD:278826 11/47 (23%)
RCC1_2 220..249 CDD:290274 0/2 (0%)
RCC1 236..286 CDD:278826
RCC1 290..341 CDD:278826
RCC1 345..395 CDD:278826
RCC1_2 386..414 CDD:290274
RCC1 402..449 CDD:278826
Eea1XP_006513585.1 SMC_prok_B <130..794 CDD:274008
Smc 504..1346 CDD:224117 50/260 (19%)
FYVE_EEA1 1394..1456 CDD:277269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.