Sequence 1: | NP_608550.1 | Gene: | CG3862 / 33261 | FlyBaseID: | FBgn0031286 | Length: | 454 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006513585.1 | Gene: | Eea1 / 216238 | MGIID: | 2442192 | Length: | 1458 | Species: | Mus musculus |
Alignment Length: | 260 | Identity: | 50/260 - (19%) |
---|---|---|---|
Similarity: | 93/260 - (35%) | Gaps: | 81/260 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KTRGIVLG------ISRSYTAKAKRGVLAQDKSKIKEYSPKTTDS-------------------- 41
Fly 42 --------HEHRVYVWGFQETGALGLQTNVKKAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFT 98
Fly 99 VYAVNRDDGETLFGSGLNTDSQLGFQVKGNPNDPANLDVIIYPTAIKLPRVQGETDEDMRVKSM- 162
Fly 163 ------SAGRAHLVVLTQNGTIFTLGNNSYGQCGRSIIEEERYSKSALIHRISQEDICGKEDEVV 221
Fly 222 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3862 | NP_608550.1 | RCC1 | 43..99 | CDD:278826 | 13/55 (24%) |
RCC1_2 | 159..188 | CDD:290274 | 6/35 (17%) | ||
RCC1 | 175..233 | CDD:278826 | 11/47 (23%) | ||
RCC1_2 | 220..249 | CDD:290274 | 0/2 (0%) | ||
RCC1 | 236..286 | CDD:278826 | |||
RCC1 | 290..341 | CDD:278826 | |||
RCC1 | 345..395 | CDD:278826 | |||
RCC1_2 | 386..414 | CDD:290274 | |||
RCC1 | 402..449 | CDD:278826 | |||
Eea1 | XP_006513585.1 | SMC_prok_B | <130..794 | CDD:274008 | |
Smc | 504..1346 | CDD:224117 | 50/260 (19%) | ||
FYVE_EEA1 | 1394..1456 | CDD:277269 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |