DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and Zzef1

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_006532664.1 Gene:Zzef1 / 195018 MGIID:2444286 Length:2953 Species:Mus musculus


Alignment Length:331 Identity:60/331 - (18%)
Similarity:93/331 - (28%) Gaps:163/331 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TNVKKAKERYTEMV-----------HHPTRLQF-----SNNNEITDVAAGYGFTVYAVNRDDGET 109
            |:.:..|.||...|           ....||||     |:|||     .||.|||.|....|...
Mouse  1141 TDSRGGKTRYDTKVGTYKWPKKVTFKDGPRLQFLFHSDSSNNE-----WGYKFTVTAYGLPDVAV 1200

  Fly   110 LFG------------------SGLNTDSQLGF--------------------------------- 123
            .:|                  ..|.:..|||.                                 
Mouse  1201 SWGLDLQLLVSRLMGRLASQCMALKSVHQLGSNMAVSQAKLTSVLNSPLWKPVFRHQICPELELE 1265

  Fly   124 ------------QVKGNPNDP-------------------------------------------- 132
                        :||..|:||                                            
Mouse  1266 ASWPTHPHKDGKEVKNIPDDPCRHFLLDFAQSEPAQNFCGPYSELFKGFIQACRKQAPKTDIVAG 1330

  Fly   133 --------ANLDVIIYPTAIKLPRVQ------GE---TDEDMRVKSMSAG-RAHLVVLTQNGTIF 179
                    |....::|.|.....::|      |:   |:|..:|.|::.| |..::.:.|. ::.
Mouse  1331 STIDQAVNATFAALVYRTPDLYEKLQKYVNSGGKIALTEEFSQVYSLADGIRIWMLEMKQK-SLL 1394

  Fly   180 TLGNNSYGQCGRSIIE-------EERYSKSALIHRI-----SQEDICGKEDEVVQVECGQDHSMF 232
            :|||:|..:.|....|       :|...||.|:.:.     |.::.|.|.:.|.:.    ||...
Mouse  1395 SLGNDSEEKRGLEAAEVNPESLAKECIQKSLLLLKFLPMSKSSKENCDKLETVDET----DHLQP 1455

  Fly   233 LTKKGR 238
            |.::.|
Mouse  1456 LDRRQR 1461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826 16/53 (30%)
RCC1_2 159..188 CDD:290274 9/29 (31%)
RCC1 175..233 CDD:278826 16/69 (23%)
RCC1_2 220..249 CDD:290274 5/19 (26%)
RCC1 236..286 CDD:278826 1/3 (33%)
RCC1 290..341 CDD:278826
RCC1 345..395 CDD:278826
RCC1_2 386..414 CDD:290274
RCC1 402..449 CDD:278826
Zzef1XP_006532664.1 EFh <94..141 CDD:238008
APC10-ZZEF1 250..380 CDD:176488
CUB <1119..1189 CDD:381774 15/52 (29%)
ZZ_EF 1779..1826 CDD:239083
ZZ 1828..1875 CDD:239069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.