DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and herc3

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_002938676.3 Gene:herc3 / 100488790 XenbaseID:XB-GENE-968537 Length:1050 Species:Xenopus tropicalis


Alignment Length:290 Identity:89/290 - (30%)
Similarity:135/290 - (46%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 GNNSYGQCG-----RSIIEEE---RYSKSALIHRISQEDICGKEDEVVQVECGQDHSMFLTKKGR 238
            |::::||.|     :..:.:.   |:|.:|          |.||     |.||..|::||.:.|:
 Frog     5 GHSTFGQLGNGHSFQGSVSDPCVCRFSLAA----------CVKE-----VACGGKHTLFLLEDGQ 54

  Fly   239 IYTCGWGADGQTGQGNYHT-AGQITLIGGDVEKEKIVRLSCSSDCVLALNEAGDAFGWGNSEYGQ 302
            :|:|||..:||.|..:..| ..|:|.:    .:|.|..::|.....|||:..|..:.||:...||
 Frog    55 VYSCGWNGEGQLGHDHEGTDPVQVTTL----TEEHITHIACGQSHNLALSYQGQLYSWGSGNDGQ 115

  Fly   303 LDDSELAETQINIPRALKLTKSIGKIKDVAAGGSFCMALNDQGLVYTWG---FGILGFG-PFVEQ 363
            |..:.: |....|||.:|.... .||:.|:.|...||||.|.|.::|||   .|.||.| .|:.|
 Frog   116 LGHATV-EHSSRIPRIIKKLNQ-QKIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGNGFLSQ 178

  Fly   364 TSKPQHL-----LPPLFGRNDFSNETTVVSIGCGVFHMGAVNSDGDLFMWGKNRFGHLGLGHKKD 423
            :| ||.:     :|             :..:..|..|..|::..|.:|.||.|..|.|||..:|.
 Frog   179 SS-PQRVKSLEGIP-------------LAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEKV 229

  Fly   424 QFFP--FKAAINGKVTKVAYGVDHTIALCK 451
            :..|  .|.....||..::.|.:||..|.|
 Frog   230 RETPCHVKPLRTHKVIYISCGEEHTAILTK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274 1/5 (20%)
RCC1 175..233 CDD:278826 14/58 (24%)
RCC1_2 220..249 CDD:290274 11/28 (39%)
RCC1 236..286 CDD:278826 15/50 (30%)
RCC1 290..341 CDD:278826 17/50 (34%)
RCC1 345..395 CDD:278826 15/58 (26%)
RCC1_2 386..414 CDD:290274 8/27 (30%)
RCC1 402..449 CDD:278826 17/48 (35%)
herc3XP_002938676.3 RCC1 3..49 CDD:395335 14/58 (24%)
ATS1 44..353 CDD:227511 76/236 (32%)
HECTc 702..1048 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.