DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and herc6

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_031759089.1 Gene:herc6 / 100487734 XenbaseID:XB-GENE-968556 Length:1030 Species:Xenopus tropicalis


Alignment Length:301 Identity:101/301 - (33%)
Similarity:148/301 - (49%) Gaps:39/301 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VKSMSAGRAHLVVLTQNGTIFTLGNNSYGQCGRSIIEEERYSKSALIHRISQEDICGKEDEVVQV 223
            |:.:|.|..|.:.|.::||:.:.|.|.|||.||.       |.::.|.:||..:    ...:|.:
 Frog    36 VQKVSCGEKHTLYLLEDGTLLSCGQNPYGQLGRK-------SNNSSIEQISSLE----AQTIVDI 89

  Fly   224 ECGQDHSMFLTKKGRIYTCGWGADGQTGQGNY----HTAGQITLIGGDVEKEKIVRLSCSSDCVL 284
            .||.:||:.::.:|.||:.|.|::||.|.||.    .|..:||    .:...||:::||.:...|
 Frog    90 SCGTNHSVAVSDEGSIYSWGDGSEGQLGTGNLSSRNFTPKKIT----GLFNTKIIQISCGNFHSL 150

  Fly   285 ALNEAGDAFGWGNSEYGQLDDSELAETQIN--IPRALKLTKSIGKIKDVAAGGSFCMALNDQGLV 347
            ||:|.|..|.||.::.|||.   |....||  .|:.:|..|.|..:: |.||||...||:..|.|
 Frog   151 ALSEDGRVFSWGQNKCGQLG---LGSQIINQATPQLVKSLKGIPLVQ-VTAGGSQSFALSMSGTV 211

  Fly   348 YTWG---FGILGF--GPFVEQTSKPQHLLPPLFGRNDFSNETTVVSIGCGVFHMGAVNSDGDLFM 407
            :.||   .|.|||  .|....|.|| |.:..|  ||     ..|..|.||..|...::.||.::.
 Frog   212 FAWGKNNAGQLGFKSDPMKAGTFKP-HAVNSL--RN-----LGVAYISCGEEHTAVLSKDGSVYT 268

  Fly   408 WGKNRFGHLGLGHKKDQFFPFKAA-INGKVTKVAYGVDHTI 447
            :|.:..|.||.........|.|.. ..|:|::||.|..||:
 Frog   269 FGDDTHGQLGQNSGNQTSVPQKIEDYAGQVSQVACGRYHTL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274 10/28 (36%)
RCC1 175..233 CDD:278826 18/57 (32%)
RCC1_2 220..249 CDD:290274 10/28 (36%)
RCC1 236..286 CDD:278826 18/53 (34%)
RCC1 290..341 CDD:278826 19/52 (37%)
RCC1 345..395 CDD:278826 20/54 (37%)
RCC1_2 386..414 CDD:290274 8/27 (30%)
RCC1 402..449 CDD:278826 15/47 (32%)
herc6XP_031759089.1 ATS1 2..373 CDD:227511 101/301 (34%)
HUL4 324..1021 CDD:227354
HECTc 684..1028 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.