DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and als2b

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_009300450.1 Gene:als2b / 100318899 ZFINID:ZDB-GENE-080929-1 Length:1706 Species:Danio rerio


Alignment Length:166 Identity:39/166 - (23%)
Similarity:71/166 - (42%) Gaps:42/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 KLPRVQGETD----------EDMRVKSMSAGRAHLVVLTQNGTIFTLGNNSYGQC---GRSIIEE 196
            :||..|.:|.          .:.||..::||.||..|:|::|.:...|.|.:|||   |.|:|  
Zfish    64 ELPWKQNQTSSAEPILEAVLSEQRVVFVAAGSAHSGVVTEDGGVHMWGENVHGQCGLLGLSVI-- 126

  Fly   197 ERYSKSALIHRISQEDICGKEDEVVQVECGQDHSMFLTKKGRIYTCGWGADGQTG---------- 251
               .....:..:..|....:..::::|.||..|::.|:.|..::  .||:..|.|          
Zfish   127 ---PNPTPVGVLDSEATPPQTVKILEVACGDQHTLALSAKHEVW--AWGSGCQLGLNTSTFPVWK 186

  Fly   252 -QGNYHTAGQITLIGGDVEKEKIVRLSCSSDCVLAL 286
             |...|.:|:           .:::::|.|...:||
Zfish   187 PQKVDHLSGR-----------HVLQVACGSAHSVAL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274 10/28 (36%)
RCC1 175..233 CDD:278826 14/60 (23%)
RCC1_2 220..249 CDD:290274 8/28 (29%)
RCC1 236..286 CDD:278826 10/60 (17%)
RCC1 290..341 CDD:278826
RCC1 345..395 CDD:278826
RCC1_2 386..414 CDD:290274
RCC1 402..449 CDD:278826
als2bXP_009300450.1 RCC1_2 88..117 CDD:290274 10/28 (36%)
RCC1 104..160 CDD:278826 14/60 (23%)
RCC1 165..211 CDD:278826 9/58 (16%)
RCC1 567..614 CDD:278826
RCC1 619..665 CDD:278826
PH_alsin 952..1065 CDD:241423
COG4642 1085..1290 CDD:226989
MORN 1104..1124 CDD:280628
MORN 1153..1173 CDD:197832
VPS9 1603..1702 CDD:280383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.