DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and herc5.3

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_021330683.1 Gene:herc5.3 / 100073325 ZFINID:ZDB-GENE-070615-14 Length:1002 Species:Danio rerio


Alignment Length:319 Identity:78/319 - (24%)
Similarity:134/319 - (42%) Gaps:66/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 EDMRVKSMSAGRAHLVVLTQNGTIFTLGNNSYGQCGRSIIEEERYSKSALIHRISQEDIC----G 215
            ::.|::|:..|.|..|:|..:|.:..:                           .|..:|    |
Zfish    80 QNERIRSIVCGEAGAVLLADDGKVLVM---------------------------DQSTVCRPLKG 117

  Fly   216 KED-EVVQVECGQDHSMFLTKKGRIYTCGWGADGQTG----QGNYHTAGQITLIGGDVEKEKIVR 275
            .|: :|:|:.||..|||.||..|:::..|..|.||.|    |....:...:..:.|    ..:.:
Zfish   118 LENRQVIQIACGDQHSMALTNDGQLFVWGENALGQLGLRKEQAGTQSPQHLQSLCG----IPVAQ 178

  Fly   276 LSCSSDCVLALNEAGDAFGWGNSEYGQLDDSELAETQI-NIPRALKLTKSIGKIKDVAAGGSFCM 339
            :|...:....|:.:|..||||::..|||...:..:..| .|.::|...|::    .::.||....
Zfish   179 ISAGGNHSFVLSLSGVVFGWGSNSAGQLGLGDTTDRFIPTIVKSLSGKKTV----SISCGGEHTA 239

  Fly   340 ALNDQGLVYTWGFGILGFGPFVEQTSKPQH---LLPPLFGRNDFSNETTVVSIGCGVFH-MGAVN 400
            .|:..|.|:|:|.|  |||.....:.|.:|   |:..|:|       :.|..:.||..| :...:
Zfish   240 TLSKGGTVFTFGSG--GFGQLGHNSLKDEHHPRLVAELWG-------SKVSQVTCGRHHTLVFED 295

  Fly   401 SDGDLFMWGKNRFGHLGLGHKKDQFFPFKAAINGKVT-----KVAYGVDHTIALCKPFF 454
            |...::.:|....|.||.|.:..|..|....:..:.|     |:..|.:|:.||   ||
Zfish   296 SSNQIYSFGCGMQGQLGNGEQVKQSVPLPVLLPTECTEFTMEKLIAGENHSFAL---FF 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274 6/28 (21%)
RCC1 175..233 CDD:278826 12/62 (19%)
RCC1_2 220..249 CDD:290274 12/28 (43%)
RCC1 236..286 CDD:278826 9/53 (17%)
RCC1 290..341 CDD:278826 14/51 (27%)
RCC1 345..395 CDD:278826 16/52 (31%)
RCC1_2 386..414 CDD:290274 6/28 (21%)
RCC1 402..449 CDD:278826 11/51 (22%)
herc5.3XP_021330683.1 RCC1 <74..349 CDD:332518 74/312 (24%)
HECTc 665..1000 CDD:331829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.