DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3862 and herc3

DIOPT Version :9

Sequence 1:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001139096.1 Gene:herc3 / 100003587 ZFINID:ZDB-GENE-090313-139 Length:1046 Species:Danio rerio


Alignment Length:236 Identity:82/236 - (34%)
Similarity:114/236 - (48%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 QVECGQDHSMFLTKKGRIYTCGWGADGQTGQGNYHTAGQITLIGGDVEKEKIVRLSCSSDCVLAL 286
            :|.||..||:||...|.:||||..:.||.|   :...|....:.|.::.:||..:||.....||:
Zfish    38 EVACGNQHSLFLLHDGSVYTCGSNSCGQLG---HDKGGSRPELVGALDAQKISGVSCGQAHSLAV 99

  Fly   287 NEAGDAFGWGNSEYGQLDDSELAETQINIPRAL-KLTKSIGKIKDVAAGGSFCMALNDQGLVYTW 350
            ||.|..|.||..:.||| ....||..:.:||.: ||.:.  :|..|..|...|:||:..|.::.|
Zfish   100 NEQGQVFAWGAGDGGQL-GLGTAEEAVRVPRLIKKLCEH--RISQVMCGNHHCIALSKDGQLFVW 161

  Fly   351 G---FGILGFGPFVEQTSKPQHLLPPLFGRNDFSNETTVVSIGCGVFHMGAVNSDGDLFMWGKNR 412
            |   .|.||.|.....|..||. |..|.|       ..:..|..|..|..|::..|.:|.||||.
Zfish   162 GENSSGQLGLGKGEPSTLSPQP-LKSLCG-------IPLTQISAGGDHSFALSFSGAVFGWGKNS 218

  Fly   413 FGHLGLGHKKDQFFP--FKAAINGKVTKVAYGVDHTIALCK 451
            .|.|||..::|:..|  .|...:.||..::.|.:||.||.|
Zfish   219 AGQLGLNDEQDRAVPCHIKFLRSQKVVYISCGEEHTAALTK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3862NP_608550.1 RCC1 43..99 CDD:278826
RCC1_2 159..188 CDD:290274
RCC1 175..233 CDD:278826 5/10 (50%)
RCC1_2 220..249 CDD:290274 12/26 (46%)
RCC1 236..286 CDD:278826 15/49 (31%)
RCC1 290..341 CDD:278826 17/51 (33%)
RCC1 345..395 CDD:278826 15/52 (29%)
RCC1_2 386..414 CDD:290274 10/27 (37%)
RCC1 402..449 CDD:278826 18/48 (38%)
herc3NP_001139096.1 RCC1 4..49 CDD:278826 5/10 (50%)
RCC1_2 37..65 CDD:290274 12/26 (46%)
RCC1 52..99 CDD:278826 15/49 (31%)
RCC1 103..152 CDD:278826 17/51 (33%)
RCC1 155..205 CDD:278826 16/57 (28%)
RCC1 208..257 CDD:278826 18/48 (38%)
RCC1 260..308 CDD:278826 82/236 (35%)
RCC1 314..374 CDD:278826
HECTc 699..1044 CDD:238033
HECTc 723..1043 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.