DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3662 and ITM2A

DIOPT Version :9

Sequence 1:NP_001162847.1 Gene:CG3662 / 33260 FlyBaseID:FBgn0031285 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_004858.1 Gene:ITM2A / 9452 HGNCID:6173 Length:263 Species:Homo sapiens


Alignment Length:239 Identity:62/239 - (25%)
Similarity:109/239 - (45%) Gaps:40/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LLFLIAVVVMLLG-VLGGWTLYRVYAPSHSSMRYHALC--EIPYPEDSMEMARVYPRTVEPFALN 126
            :|.|:.:..:|.| ::||..:|:.:.|. |::....:|  :...|.:|:       |..||    
Human    54 MLTLLGLSFILAGLIVGGACIYKYFMPK-STIYRGEMCFFDSEDPANSL-------RGGEP---- 106

  Fly   127 WRSLLPELAQPMPNSGSLDESHFREDIELDGDSDDEGYARVDVPDFKDGRRGRFMHDFKENQSAI 191
              :.||          ..:|:..|||       |:.....|.||.|.|......:|||::..:|.
Human   107 --NFLP----------VTEEADIRED-------DNIAIIDVPVPSFSDSDPAAIIHDFEKGMTAY 152

  Fly   192 IDTTTGRCFIMPLDRDTTLPPTSFVDLIKKMSTGYYNIDTERVRRQMRVVMPRITDVSLISERIA 256
            :|...|.|::|||:....:||.:.|:|..|:::|.|...|..||..: |.:..|.|||.:...|.
Human   153 LDLLLGNCYLMPLNTSIVMPPKNLVELFGKLASGRYLPQTYVVREDL-VAVEEIRDVSNLGIFIY 216

  Fly   257 NECFDMKVYMMEK--FVSGVSKRSADPLPESAKYAEFMGKGVIE 298
            ..|.:.|.:.:.:  .:.|.:||:.|   :..|...|..:.::|
Human   217 QLCNNRKSFRLRRRDLLLGFNKRAID---KCWKIRHFPNEFIVE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3662NP_001162847.1 BRICHOS 172..267 CDD:198107 30/94 (32%)
ITM2ANP_004858.1 BRICHOS 133..225 CDD:198107 30/92 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158671
Domainoid 1 1.000 54 1.000 Domainoid score I11224
eggNOG 1 0.900 - - E1_KOG4681
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5339
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322680at2759
OrthoFinder 1 1.000 - - FOG0001782
OrthoInspector 1 1.000 - - otm41126
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10962
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3365
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.