DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3662 and Itm2c

DIOPT Version :9

Sequence 1:NP_001162847.1 Gene:CG3662 / 33260 FlyBaseID:FBgn0031285 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_071862.2 Gene:Itm2c / 64294 MGIID:1927594 Length:269 Species:Mus musculus


Alignment Length:232 Identity:51/232 - (21%)
Similarity:87/232 - (37%) Gaps:59/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RPQHH-----------CIKSFLLFLIAVVVMLLG-VLGGWTLYRVYAPSHSSMRYHALCEIPYPE 107
            ||..|           |..|     :.:||:|:| |.....:||.:..:..:......|.:.| |
Mouse    45 RPPRHRSRKGGSVGGVCYLS-----MGMVVLLMGLVFASVYIYRYFFLAQLARDNFFHCGVLY-E 103

  Fly   108 DSMEMARVYPRTVEPFALNWRSLLPELAQPMPNSGSLDESHFREDIELDGDSD---DEGYARVD- 168
            ||:                                   .|..|..:||:.|..   :|.|.|:: 
Mouse   104 DSL-----------------------------------SSQIRTRLELEEDVKIYLEENYERINV 133

  Fly   169 -VPDFKDGRRGRFMHDFKENQSAIIDTTTGRCFIMPLDRDTTLPPTSFVDLIKKMSTGYYNIDTE 232
             ||.|..|.....:|||:...:|..|.:..:|:::.|:....|||.:|.:|:..:..|.|...|.
Mouse   134 PVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFWELLMNVKRGTYLPQTY 198

  Fly   233 RVRRQMRVVMPRITDVSLISERIANECFDMKVYMMEK 269
            .::.:| ||...:.|...:...|.:.|.....|.:.:
Mouse   199 IIQEEM-VVTEHVRDKEALGSFIYHLCNGKDTYRLRR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3662NP_001162847.1 BRICHOS 172..267 CDD:198107 24/94 (26%)
Itm2cNP_071862.2 BRICHOS 138..230 CDD:198107 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849071
Domainoid 1 1.000 51 1.000 Domainoid score I11483
eggNOG 1 0.900 - - E1_KOG4681
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5342
Isobase 1 0.950 - 0 Normalized mean entropy S7101
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001782
OrthoInspector 1 1.000 - - otm43193
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10962
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3365
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.