DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3662 and itm2bb

DIOPT Version :9

Sequence 1:NP_001162847.1 Gene:CG3662 / 33260 FlyBaseID:FBgn0031285 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_998141.1 Gene:itm2bb / 406248 ZFINID:ZDB-GENE-040426-2139 Length:254 Species:Danio rerio


Alignment Length:264 Identity:68/264 - (25%)
Similarity:112/264 - (42%) Gaps:45/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DNEADAESMVFNRPQHH----CIKSFLLFLIAVVVMLLG-VLGGWTLYRVYAPSHSSMRYHALCE 102
            :.|.|.|::|..|.|..    |      |.:.:.::|.| |:.|..|||.|......:   .:|.
Zfish    22 NEEQDPEAVVLVRHQSRVWCWC------FCLGLTLVLSGVVVAGAYLYRYYVLERDQV---FICG 77

  Fly   103 IPYPEDSMEMARVYPRTVEPFALNWRSLLPELAQPMPNSGSLDES-HFREDIELDGDSDDEGYAR 166
            :.|.|             |.:.|| ..:.||:..|:   ..::|: .|.||.|::       ...
Zfish    78 LKYYE-------------EDYELN-EEVDPEIGAPL---RLIEENVSFFEDDEVE-------LIS 118

  Fly   167 VDVPDFKDGRRGRFMHDFKENQSAIIDTTTGRCFIMPLDRDTTLPPTSFVDLIKKMSTGYYNIDT 231
            |.||:|||......:|||....:|.:|....:|:|:.|:....:||..|.:.:..:..|.|...|
Zfish   119 VPVPEFKDSDPAGILHDFTMKLTAYLDLNLDKCYIITLNTSVVMPPRDFQEFLVNIKEGMYLPQT 183

  Fly   232 ERVRRQMRVVMPRITDVSLISERIANECFDMKVYMMEK--FVSGVSKRSADPLPESAKYAEFMGK 294
            ..:..:| :|..::.|.|.:...|.|.|.|...|.:::  .:.|:.||.|   ....|...|..|
Zfish   184 YLIHEEM-MVTEKLDDTSDLGYYINNLCKDKDTYRLQRRDTILGMQKREA---LNCHKIRHFENK 244

  Fly   295 GVIE 298
            .|:|
Zfish   245 FVVE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3662NP_001162847.1 BRICHOS 172..267 CDD:198107 26/94 (28%)
itm2bbNP_998141.1 BRICHOS 124..218 CDD:198107 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594623
Domainoid 1 1.000 47 1.000 Domainoid score I11984
eggNOG 1 0.900 - - E1_KOG4681
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5345
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322680at2759
OrthoFinder 1 1.000 - - FOG0001782
OrthoInspector 1 1.000 - - oto40733
orthoMCL 1 0.900 - - OOG6_108495
Panther 1 1.100 - - O PTHR10962
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17352
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.