DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3662 and itm2b

DIOPT Version :9

Sequence 1:NP_001162847.1 Gene:CG3662 / 33260 FlyBaseID:FBgn0031285 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_989241.1 Gene:itm2b / 394850 XenbaseID:XB-GENE-986226 Length:257 Species:Xenopus tropicalis


Alignment Length:223 Identity:59/223 - (26%)
Similarity:97/223 - (43%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CIKSFLLFLIAVVVMLLGVLGGWTLYRVYAPSHSSMRYHALCEIPYPEDSMEMARVYPRTVEPFA 124
            |:...|.|::|.:     ||||..||:.:|    ..|....|.|.|.||...:...|..|    .
 Frog    48 CMCFGLAFMLAGI-----VLGGAYLYKYFA----MQRGVYFCGIRYLEDDAALTEPYAET----P 99

  Fly   125 LNWRSLLPELAQPMPNSGSLDESHFREDIELDGDSDDEGYARVDVPDFKDGRRGRFMHDFKENQS 189
            :.:.|                   |:|.|::..:.|.| ...|.||:|.|......:|||....:
 Frog   100 VRYHS-------------------FKESIQILEEEDVE-LINVPVPEFADNDPVDIVHDFHRKLT 144

  Fly   190 AIIDTTTGRCFIMPLDRDTTLPPTSFVDLIKKMSTGYYNIDTERVRRQMRVVMPRITDVSLISER 254
            |.:|....:|:::||:....:||.:|::|:..:..|.|...:..|..|| :|..||.:|..:...
 Frog   145 AYLDLNLNKCYVIPLNTSIVMPPKNFLELLLNIKAGTYLPQSYLVHEQM-IVTDRIENVDQLGFF 208

  Fly   255 IANECFDMKVYMMEK--FVSGVSKRSAD 280
            |...|.|.:.|.:::  .:.|..||.|:
 Frog   209 IYRLCRDKETYKLQRKETIRGFQKREAE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3662NP_001162847.1 BRICHOS 172..267 CDD:198107 27/94 (29%)
itm2bNP_989241.1 BRICHOS 127..221 CDD:198107 27/94 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11397
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5131
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322680at2759
OrthoFinder 1 1.000 - - FOG0001782
OrthoInspector 1 1.000 - - otm48331
Panther 1 1.100 - - LDO PTHR10962
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.