DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3662 and itm2cb

DIOPT Version :9

Sequence 1:NP_001162847.1 Gene:CG3662 / 33260 FlyBaseID:FBgn0031285 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_021334771.1 Gene:itm2cb / 335863 ZFINID:ZDB-GENE-030131-7806 Length:345 Species:Danio rerio


Alignment Length:259 Identity:56/259 - (21%)
Similarity:98/259 - (37%) Gaps:58/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DQEKVPLPMNLNDEALMHHGSLIAPKVAYSDNEADAESMVFNRPQHHCIKSFLLFLIAVVVMLLG 77
            |:|::.:|.:..||.::...|..:|                       .......::.:|:.|.|
Zfish   106 DKEEIQMPYSHKDELVLPVRSKKSP-----------------------FSGLWCVVLGLVIFLSG 147

  Fly    78 -VLGGWTLYRVYAPSHSSMRYHALCEIPYPEDSMEMAR-VYPRTVEPFALNWRSLLPELAQPMPN 140
             ::....|||.|....            .||||....| :|...|  ||            |:..
Zfish   148 LIMASVCLYRYYFNPQ------------IPEDSFFHCRMMYEDPV--FA------------PLLG 186

  Fly   141 SGSLDESHFREDIELDGDSDDEGYARVDVPDFKDGRRGRFMHDFKENQSAIIDTTTGRCFIMPLD 205
            ...|:|   :..|.||   |:.....|.||||..|.....:|||....:|..|....:|:::.|:
Zfish   187 RQELEE---KVGIYLD---DNYEQISVPVPDFGSGDPADIIHDFHRGLTAYYDIALDKCYVIELN 245

  Fly   206 RDTTLPPTSFVDLIKKMSTGYYNIDTERVRRQMRVVMPRITDVSLISERIANECFDMKVYMMEK 269
            ....:||.:..:|:..:..|.|...|..::.:| ||..|:.::..:...|...|:..:.|.:.:
Zfish   246 TTIVMPPRNLWELLVNVKRGTYLPQTYMIQEEM-VVTGRVRNLRQLGPFIHRLCYAKETYRLRR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3662NP_001162847.1 BRICHOS 172..267 CDD:198107 22/94 (23%)
itm2cbXP_021334771.1 BRICHOS 212..304 CDD:198107 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594624
Domainoid 1 1.000 47 1.000 Domainoid score I11984
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5345
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322680at2759
OrthoFinder 1 1.000 - - FOG0001782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10962
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3365
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.120

Return to query results.
Submit another query.