DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3662 and Itm2a

DIOPT Version :9

Sequence 1:NP_001162847.1 Gene:CG3662 / 33260 FlyBaseID:FBgn0031285 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001020883.1 Gene:Itm2a / 317218 RGDID:1559423 Length:263 Species:Rattus norvegicus


Alignment Length:238 Identity:61/238 - (25%)
Similarity:107/238 - (44%) Gaps:38/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LLFLIAVVVMLLG-VLGGWTLYRVYAPSHSSMRYHA-LCEIPYPEDSMEMARVYPRTVEPFALNW 127
            :|.|:.:..:|.| ::||..:|:.:.|  .|..||. :|... .||::...    ...:|:.|  
  Rat    54 MLTLLGLSFILAGLIVGGACIYKYFMP--KSTIYHGEMCFFD-SEDAVNSI----HGGQPYFL-- 109

  Fly   128 RSLLPELAQPMPNSGSLDESHFREDIELDGDSDDEGYARVDVPDFKDGRRGRFMHDFKENQSAII 192
                     |:     .:|:..|||       |:.....|.||.|.|......:|||::..:|.:
  Rat   110 ---------PV-----TEEADIRED-------DNIAIIDVPVPSFSDSDPAAIIHDFEKGMTAYL 153

  Fly   193 DTTTGRCFIMPLDRDTTLPPTSFVDLIKKMSTGYYNIDTERVRRQMRVVMPRITDVSLISERIAN 257
            |...|.|::|||:....:.|.:.|:|..|:::|.|...|..||..: |.:..|.|||.:...|..
  Rat   154 DLLLGNCYLMPLNTSIVMTPKNLVELFGKLASGKYLPHTYVVREDL-VAVEEIRDVSNLGIFIYQ 217

  Fly   258 ECFDMKVYMMEK--FVSGVSKRSADPLPESAKYAEFMGKGVIE 298
            .|.:.|.:.:.:  .:.|.:||:.|   :..|...|..:.::|
  Rat   218 LCNNRKSFRLRRRDLLLGFNKRAID---KCWKIRHFPNEFIVE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3662NP_001162847.1 BRICHOS 172..267 CDD:198107 29/94 (31%)
Itm2aNP_001020883.1 BRICHOS 133..225 CDD:198107 29/92 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352682
Domainoid 1 1.000 51 1.000 Domainoid score I11269
eggNOG 1 0.900 - - E1_KOG4681
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5209
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322680at2759
OrthoFinder 1 1.000 - - FOG0001782
OrthoInspector 1 1.000 - - otm45267
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10962
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.