DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3662 and Itm2c

DIOPT Version :9

Sequence 1:NP_001162847.1 Gene:CG3662 / 33260 FlyBaseID:FBgn0031285 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001009674.1 Gene:Itm2c / 301575 RGDID:1309503 Length:269 Species:Rattus norvegicus


Alignment Length:244 Identity:54/244 - (22%)
Similarity:93/244 - (38%) Gaps:61/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RPQHH-----------CIKSFLLFLIAVVVMLLG-VLGGWTLYRVYAPSHSSMRYHALCEIPYPE 107
            ||..|           |..|     :.:||:|:| |.....:||.:..:..:......|.:.| |
  Rat    45 RPPRHRSRKGGSVGGVCYLS-----MGMVVLLMGLVFASVYIYRYFFLAQLARDNFFHCGVLY-E 103

  Fly   108 DSMEMARVYPRTVEPFALNWRSLLPELAQPMPNSGSLDESHFREDIELDGDSD---DEGYARVD- 168
            ||:                                   .|..|..:||:.|..   :|.|.|:: 
  Rat   104 DSL-----------------------------------SSQIRTRLELEEDVKIYLEENYERINV 133

  Fly   169 -VPDFKDGRRGRFMHDFKENQSAIIDTTTGRCFIMPLDRDTTLPPTSFVDLIKKMSTGYYNIDTE 232
             ||.|..|.....:|||:...:|..|.:..:|:::.|:....|||.:|.:|:..:..|.|...|.
  Rat   134 PVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFWELLMNVKRGTYLPQTY 198

  Fly   233 RVRRQMRVVMPRITDVSLISERIANECFDMKVYMMEKFVS--GVSKRSA 279
            .::.:| ||...:.|...:...|.:.|.....|.:.:..:  .::||.|
  Rat   199 IIQEEM-VVTEHVRDKEALGSFIYHLCNGKDTYRLRRRATRRRINKRGA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3662NP_001162847.1 BRICHOS 172..267 CDD:198107 24/94 (26%)
Itm2cNP_001009674.1 BRICHOS 138..230 CDD:198107 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352680
Domainoid 1 1.000 51 1.000 Domainoid score I11269
eggNOG 1 0.900 - - E1_KOG4681
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5209
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322680at2759
OrthoFinder 1 1.000 - - FOG0001782
OrthoInspector 1 1.000 - - otm45267
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10962
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.