DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3662 and Itm2b

DIOPT Version :9

Sequence 1:NP_001162847.1 Gene:CG3662 / 33260 FlyBaseID:FBgn0031285 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_032436.1 Gene:Itm2b / 16432 MGIID:1309517 Length:266 Species:Mus musculus


Alignment Length:260 Identity:61/260 - (23%)
Similarity:111/260 - (42%) Gaps:37/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DEALMHHGSLIAPKVAYSDNEADAESMV---FNRPQHHCIKSFLLFLIAVVVMLLGVLGGWTLYR 86
            ||......:||.|..|.:.:..|...:|   ..|....|:...|.|::|.|     :|||..||:
Mouse    18 DEPKSSEEALIVPPDAVAVDCKDPGDVVPVGQRRAWCWCMCFGLAFMLAGV-----ILGGAYLYK 77

  Fly    87 VYAPSHSSMRYHALCEIPYPEDSMEMARVYPRTVEPFALNWRSLLPELAQPMPNSGSLDESHFRE 151
            .:|.....:.|   |.:.|.:|.:             .||         :|..::.:.......|
Mouse    78 YFALQPDDVYY---CGLKYIKDDV-------------ILN---------EPSADAPAARYQTIEE 117

  Fly   152 DIELDGDSDDEGYARVDVPDFKDGRRGRFMHDFKENQSAIIDTTTGRCFIMPLDRDTTLPPTSFV 216
            :|:: .:.|...:..|.||:|.|......:|||.:..:|.:|....:|:::||:....:||.:.:
Mouse   118 NIKI-FEEDAVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPKNLL 181

  Fly   217 DLIKKMSTGYYNIDTERVRRQMRVVMPRITDVSLISERIANECFDMKVYMMEK--FVSGVSKRSA 279
            :|:..:..|.|...:..:...| |:..||.:|..:...|...|.|.:.|.:::  .:.|:.||.|
Mouse   182 ELLINIKAGTYLPQSYLIHEHM-VITDRIENVDNLGFFIYRLCHDKETYKLQRRETIRGIQKREA 245

  Fly   280  279
            Mouse   246  245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3662NP_001162847.1 BRICHOS 172..267 CDD:198107 24/94 (26%)
Itm2bNP_032436.1 Necessary for interaction with APP and inhibitor effects on APP processing. /evidence=ECO:0000250 102..134 5/32 (16%)
BRICHOS 137..231 CDD:198107 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849072
Domainoid 1 1.000 51 1.000 Domainoid score I11483
eggNOG 1 0.900 - - E1_KOG4681
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5342
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322680at2759
OrthoFinder 1 1.000 - - FOG0001782
OrthoInspector 1 1.000 - - otm43193
orthoMCL 1 0.900 - - OOG6_108495
Panther 1 1.100 - - LDO PTHR10962
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3365
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.