DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Clp and ZC3H8

DIOPT Version :9

Sequence 1:	NP_477156.1	Gene:	Clp / 33259	FlyBaseID:	FBgn0015621	Length:	296	Species:	Drosophila melanogaster
Sequence 2:	NP_115883.2	Gene:	ZC3H8 / 84524	HGNCID:	30941	Length:	291	Species:	Homo sapiens

Alignment Length:	138	Identity:	37/138 - (26%)
Similarity:	53/138 - (38%)	Gaps:	43/138 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly    69 VCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLHIDPQSKVKDCPWYKRGF 133
            :||::|...|.|||||:|.|:.::.|..|.                           |.:|.:|:
Human   196 ICKYFLERKCIKGDQCKFDHDAEIEKKKEM---------------------------CKFYVQGY 233

  Fly   134 CRHGPHCRHQHLRRVLCMDYLAGF-CPEGPSCKHMHPHFELPPLAELGKDQLHKKLPTCHYCGEL 197
            |..|.:|.:.| ....|..|..|. |.:|..||..|     .||....::.|.|.|.|
Human   234 CTRGENCLYLH-NEYPCKFYHTGTKCYQGEYCKFSH-----APLTPETQELLAKVLDT------- 285

  Fly   198 GHKANSCK 205
              :..|||
Human   286 --EKKSCK 291

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Clp	NP_477156.1	YTH1	12..175	CDD:227416	28/106 (26%)
Clp	NP_477156.1	ZnF_C3H1	66..90	CDD:214632	11/20 (55%)
ZC3H8	NP_115883.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..26
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	51..75
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	93..179
		ZnF_C3H1	<226..246	CDD:214632	7/20 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5084
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810