DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and CPSF30

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_174334.2 Gene:CPSF30 / 839925 AraportID:AT1G30460 Length:631 Species:Arabidopsis thaliana


Alignment Length:285 Identity:75/285 - (26%)
Similarity:110/285 - (38%) Gaps:85/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LANVSGLQFKAERDL----IEQVGAIPL--------------PFYGMDKSIAAVCNFITRNGQEC 51
            :.:..||.|..|..|    ::...::|:              |.|  |.|.|.|..        .
plant     1 MEDADGLSFDFEGGLDSGPVQNTASVPVAPPENSSSAAVNVAPTY--DHSSATVAG--------A 55

  Fly    52 DKGSACPFRHIRGDRTIVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLH 116
            .:|        |..|..||:|||||||.|||.|.|||::|..:||.|.|:..:..|..::|.:.|
plant    56 GRG--------RSFRQTVCRHWLRGLCMKGDACGFLHQFDKARMPICRFFRLYGECREQDCVYKH 112

  Fly   117 IDPQSKVKDCPWYKRGFCRHGPHCRHQHLRRVLCMDYLAGFCPEGPSCKHMHPHFELPPLAE-LG 180
            .:  ..:|:|..||.|||.:||.||::|.:.            .||.          ||:.| |.
plant   113 TN--EDIKECNMYKLGFCPNGPDCRYRHAKL------------PGPP----------PPVEEVLQ 153

  Fly   181 KDQLHKKLPTCHY-CGELGHKANSCKQYVGSLEHRNNINAMDHSGGHSGGYSGHSGHIEGADDMQ 244
            |.|   :|.|.:| ...|....|...|    |:.|..            |.....|..:.:.::|
plant   154 KIQ---QLTTYNYGTNRLYQARNVAPQ----LQDRPQ------------GQVPMQGQPQESGNLQ 199

  Fly   245 SNHHSQP----HGPGFVKVPTPLEE 265
            .....||    |......:|.|.::
plant   200 QQQQQQPQQSQHQVSQTLIPNPADQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 51/180 (28%)
ZnF_C3H1 66..90 CDD:214632 17/23 (74%)
CPSF30NP_174334.2 YTH1 <59..>138 CDD:227416 37/80 (46%)
YTH 238..372 CDD:410979
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002750
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.