DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and Zc3h6

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_848491.2 Gene:Zc3h6 / 78751 MGIID:1926001 Length:1177 Species:Mus musculus


Alignment Length:153 Identity:39/153 - (25%)
Similarity:55/153 - (35%) Gaps:52/153 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PLPFYGMD----------KSIAAVCNFITRNGQECDKGSACPFRHIRGDRTIVCKHWLRGLCKKG 81
            |..|.|||          |.......||.::..| .||..            :||::|.|.|.||
Mouse   236 PYVFSGMDDFQEYSKPGKKWKVMTQEFINQHTVE-HKGKQ------------ICKYFLEGRCIKG 287

  Fly    82 DQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLHIDPQSKVKDCPWYKRGFCRHGPHCRHQHLR 146
            |.|:|.|:.::.|..|.                           |.:|.:|:|..|.:|.:.| .
Mouse   288 DHCKFNHDAELEKKKEV---------------------------CKYYLQGYCTKGENCIYMH-S 324

  Fly   147 RVLCMDYLAGF-CPEGPSCKHMH 168
            ...|..|.:|. |.:|..||..|
Mouse   325 EFPCKFYHSGAKCYQGDKCKFSH 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 39/153 (25%)
ZnF_C3H1 66..90 CDD:214632 11/23 (48%)
Zc3h6NP_848491.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..137
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..206
ZnF_C3H1 274..295 CDD:214632 10/32 (31%)
ZnF_C3H1 301..325 CDD:214632 8/51 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..416
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 446..587
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..654
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 670..767
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 780..826
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 942..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1043..1101
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1132..1162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.