DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and zc3h3

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_017950172.1 Gene:zc3h3 / 733707 XenbaseID:XB-GENE-995650 Length:830 Species:Xenopus tropicalis


Alignment Length:225 Identity:62/225 - (27%)
Similarity:90/225 - (40%) Gaps:50/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CNFITRNGQECDKGSACPFRHIRGDRTIVCKHWLRGLCKKGD-QCEFLHEYDMTKMPECYFYSRF 104
            |.:..|.| :|::|..|||.| ..::..||..:|||.|||.| .|.|.|:....|||.|.::.: 
 Frog   617 CMYYNRFG-KCNRGQNCPFIH-DPEKVAVCTRFLRGTCKKTDGTCPFSHKVSKDKMPVCSYFLK- 678

  Fly   105 NACHNKECPFLHIDPQSKVKDCPWYKRGFCRHGPHCRHQHLRRVLCMDYLA-GFCPEGPSCKHMH 168
            ..|||.:||:.|:....|.:.|..:.:|:|..|..|:.:|  .:.|.||.. |.||.|..||..|
 Frog   679 GICHNNDCPYSHVYVSRKAEICKDFLKGYCPLGAKCKKKH--TLQCPDYARDGKCPNGAKCKLQH 741

  Fly   169 PHFELPPLAELGKDQLHKKLPTCHYCGELGHKANSCKQYVGSLEHRNNI--NAMDHSGGHSGGYS 231
                          :..||.|                         .|:  :.....||..|..:
 Frog   742 --------------RQRKKRP-------------------------ENVAQSEWPRPGGRQGQSA 767

  Fly   232 GHS--GHIEGADDMQSNHHSQPHGPGFVKV 259
            |.|  |..:.|.|...........|.|:.:
 Frog   768 GASAIGSTDTASDEDLGRSRMQTLPAFISL 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 48/135 (36%)
ZnF_C3H1 66..90 CDD:214632 12/24 (50%)
zc3h3XP_017950172.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.