DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and CPSF4L

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_011523417.1 Gene:CPSF4L / 642843 HGNCID:33632 Length:190 Species:Homo sapiens


Alignment Length:168 Identity:96/168 - (57%)
Similarity:125/168 - (74%) Gaps:2/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDILLANVSGLQFKAERDLIEQVGAIPLPFYGMDKSIAAVCNFITRNGQECDKGSACPFRHIRGD 65
            |..::|.:....|..|:|:..|.|...|||.|||||.:|||||.|:.  .|:||..|||||.||:
Human    23 MQEVIAGLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKG--LCEKGKLCPFRHDRGE 85

  Fly    66 RTIVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLHIDPQSKVKDCPWYK 130
            :.:||||||||||||||.|:|||:||:|:||||||||:|..|.||||.|||:.|..|.:|||||.
Human    86 KMVVCKHWLRGLCKKGDHCKFLHQYDLTRMPECYFYSKFGDCSNKECSFLHVKPAFKSQDCPWYD 150

  Fly   131 RGFCRHGPHCRHQHLRRVLCMDYLAGFCPEGPSCKHMH 168
            :|||:.||.|:::|:.|::|::||.|||||||.|:..|
Human   151 QGFCKDGPLCKYRHVPRIMCLNYLVGFCPEGPKCQFAH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 94/157 (60%)
ZnF_C3H1 66..90 CDD:214632 18/23 (78%)
CPSF4LXP_011523417.1 YTH1 34..>182 CDD:227416 90/149 (60%)
ZnF_C3H1 85..108 CDD:214632 16/22 (73%)
ZnF_C3H1 141..166 CDD:214632 13/24 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I9043
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472764at2759
OrthoFinder 1 1.000 - - FOG0002750
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23102
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.