DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and Zc3h8

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_065619.2 Gene:Zc3h8 / 57432 MGIID:1930128 Length:305 Species:Mus musculus


Alignment Length:109 Identity:34/109 - (31%)
Similarity:47/109 - (43%) Gaps:25/109 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VCKHWLRGLCKKGDQCEFLHEYDMTKMPE-CYFYSRFNACHNKECPFLHIDPQSKVKDCPWYKRG 132
            |||::|...|.|||||:|.|:.::.|..| |.:|.:......:.|.:||.:     ..|.:|..|
Mouse   210 VCKYFLERKCIKGDQCKFDHDAEIEKKKEMCKYYVQGYCTKGENCLYLHSE-----YPCKFYHTG 269

  Fly   133 F-CRHGPHCRHQH----------LRRVLCMDYLAGFCPEGPSCK 165
            . |..|.||...|          |.:||..|        ..|||
Mouse   270 TKCYQGDHCNFSHAPLTAETQELLAKVLDTD--------KKSCK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 34/109 (31%)
ZnF_C3H1 66..90 CDD:214632 12/20 (60%)
Zc3h8NP_065619.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..191
ZnF_C3H1 <240..260 CDD:214632 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.