DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and cpsf4l

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001016803.1 Gene:cpsf4l / 549557 XenbaseID:XB-GENE-1005450 Length:269 Species:Xenopus tropicalis


Alignment Length:298 Identity:145/298 - (48%)
Similarity:185/298 - (62%) Gaps:41/298 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDILLANVSGLQFKAERDLIEQVGAIPLPFYGMDKSIAAVCNFITRNGQECDKGSACPFRHIRGD 65
            |..|:|::....|..|:|:..|.||:.|||.|||||.||||:|..:.  .|.|||.|||||:.|:
 Frog     1 MQELIASIEKFSFDLEKDIEGQRGALLLPFQGMDKSGAAVCDFYVKG--ICRKGSTCPFRHLNGE 63

  Fly    66 RTIVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLHIDPQSKVKDCPWYK 130
            :|:||||||||||||||||||||||||.:||||||||:|..|.||:||||||||.|||||||||.
 Frog    64 KTVVCKHWLRGLCKKGDQCEFLHEYDMGRMPECYFYSKFGECSNKDCPFLHIDPASKVKDCPWYD 128

  Fly   131 RGFCRHGPHCRHQHLRRVLCMDYLAGFCPEGPSCKHMHPHFELPPLAELGKDQLHKKLPTCHYCG 195
            ||||:|||.|:|:|.|||:|.:||.|||||||.||::||..:|.                  .|.
 Frog   129 RGFCKHGPACKHRHTRRVMCANYLVGFCPEGPKCKYVHPKADLV------------------LCN 175

  Fly   196 ELGHKANSCKQYVGSLEHRNNINAMDHSGGHSGGYSGHS--GHI-------EGADDMQSNHHSQP 251
            ....|..:.:|...:.....::.|:   ..|.|....||  .|:       |....:|.|.:   
 Frog   176 ADHPKNPAVQQRFPATSLPCDLEAI---AKHQGLMLEHSRLSHLTVISMVQERIRKLQENVY--- 234

  Fly   252 HGPGFVKVPTPLEEITCYKCGNKGHYANKCPKGHLAFL 289
               |.::   |||::||:|||.:|||||||.:..|||:
 Frog   235 ---GGLR---PLEQVTCFKCGERGHYANKCNRSRLAFM 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 111/162 (69%)
ZnF_C3H1 66..90 CDD:214632 21/23 (91%)
cpsf4lNP_001016803.1 YTH1 <46..187 CDD:227416 94/160 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4549
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 323 1.000 Inparanoid score I2465
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472764at2759
OrthoFinder 1 1.000 - - FOG0002750
OrthoInspector 1 1.000 - - otm47448
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2013
SonicParanoid 1 1.000 - - X2133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.