DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and Cpsf4l

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_030101983.1 Gene:Cpsf4l / 52670 MGIID:1277182 Length:295 Species:Mus musculus


Alignment Length:222 Identity:89/222 - (40%)
Similarity:120/222 - (54%) Gaps:56/222 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDILLANVSGLQFKAERDLIEQVGAIPLPFYGMD------------------------------- 34
            |:.::|.:.|..|..|.|:..|.|...|||.|||                               
Mouse     1 MEEVIAGLQGFTFAFELDVESQKGTGLLPFQGMDSEWRCLCPLLRSWRCCASLPHSFWVFTARDR 65

  Fly    35 ----------------------KSIAAVCNFITRNGQECDKGSACPFRHIRGDRTIVCKHWLRGL 77
                                  :|.:|||||..:.  .|.||..||.||.:|::.:|||||||||
Mouse    66 KADFRAARAPWVPPKPSTSCLRESSSAVCNFFAKG--LCVKGMLCPLRHEQGEKLVVCKHWLRGL 128

  Fly    78 CKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLHIDPQSKVKDCPWYKRGFCRH-GPHCR 141
            |:|.|.|:|||:||::|||.|||:|:|..|.||||.|||:.|..|::|||||.:|||:. ||.|:
Mouse   129 CRKSDCCDFLHQYDVSKMPVCYFHSKFGNCSNKECLFLHLKPVLKLQDCPWYNQGFCKEVGPLCK 193

  Fly   142 HQHLRRVLCMDYLAGFCPEGPSCKHMH 168
            ::|:.:|||.:|..|||||||.|:..|
Mouse   194 YRHVHQVLCPNYFTGFCPEGPQCQFGH 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 86/211 (41%)
ZnF_C3H1 66..90 CDD:214632 16/23 (70%)
Cpsf4lXP_030101983.1 YTH1 <84..>215 CDD:227416 72/132 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6143
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472764at2759
OrthoFinder 1 1.000 - - FOG0002750
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23102
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.