Sequence 1: | NP_477156.1 | Gene: | Clp / 33259 | FlyBaseID: | FBgn0015621 | Length: | 296 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_940983.2 | Gene: | ZC3H6 / 376940 | HGNCID: | 24762 | Length: | 1189 | Species: | Homo sapiens |
Alignment Length: | 266 | Identity: | 62/266 - (23%) |
---|---|---|---|
Similarity: | 90/266 - (33%) | Gaps: | 101/266 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 VCKHWLRGLCKKGDQCEFLHEYDMTKMPE-CYFYSRFNACHNKECPFLHID-PQSKVKDCPWYKR 131
Fly 132 GF-CRHGPHCRHQH----------LRRVLCMDYL--------------------------AGFCP 159
Fly 160 EGPSCKHMHPHF------------------ELPPLAELGKDQLHKKLPTCHYCGELGHKANSC-- 204
Fly 205 ------KQYVGSLEHRNNINAMDHSGGHSGG-----YSGHSGHI--EGADDMQSNHHSQPHGPGF 256
Fly 257 VKVPTP 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Clp | NP_477156.1 | YTH1 | 12..175 | CDD:227416 | 36/162 (22%) |
ZnF_C3H1 | 66..90 | CDD:214632 | 12/20 (60%) | ||
ZC3H6 | NP_940983.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..105 | ||
ZnF_C3H1 | 276..297 | CDD:214632 | 11/19 (58%) | ||
ZnF_C3H1 | 303..327 | CDD:214632 | 6/23 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 451..530 | 19/74 (26%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 630..659 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 676..755 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 947..1026 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1051..1189 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5084 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |