DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and ZC3H6

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_940983.2 Gene:ZC3H6 / 376940 HGNCID:24762 Length:1189 Species:Homo sapiens


Alignment Length:266 Identity:62/266 - (23%)
Similarity:90/266 - (33%) Gaps:101/266 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VCKHWLRGLCKKGDQCEFLHEYDMTKMPE-CYFYSRFNACHNKECPFLHID-PQSKVKDCPWYKR 131
            :||::|.|.|.|||||:|.|:.::.|..| |.||.:......:.|.::|.: |      |.:|..
Human   277 ICKYFLEGRCIKGDQCKFDHDAELEKRKEICKFYLQGYCTKGENCIYMHNEFP------CKFYHS 335

  Fly   132 GF-CRHGPHCRHQH----------LRRVLCMDYL--------------------------AGFCP 159
            |. |..|.:|:..|          |.:||..|..                          .|..|
Human   336 GAKCYQGDNCKFSHDDLTKETKKLLDKVLNTDEELINEDERELEELRKRGITPLPKPPPGVGLLP 400

  Fly   160 EGPSCKHMHPHF------------------ELPPLAELGKDQLHKKLPTCHYCGELGHKANSC-- 204
            ..|.      ||                  ::|.|.|:      ...||.....::|.|..:.  
Human   401 TPPE------HFPFSDPEDDFQTDFSDDFRKIPSLFEI------VVKPTVDLAHKIGRKPPAFYT 453

  Fly   205 ------KQYVGSLEHRNNINAMDHSGGHSGG-----YSGHSGHI--EGADDMQSNHHSQPHGPGF 256
                  .|:.||..|..:|    :|.|.|.|     ..|||..:  .|:    ..||.....|| 
Human   454 SASPPGPQFQGSSPHPQHI----YSSGSSPGPGPNMSQGHSSPVMHPGS----PGHHPCAGPPG- 509

  Fly   257 VKVPTP 262
              :|.|
Human   510 --LPVP 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 36/162 (22%)
ZnF_C3H1 66..90 CDD:214632 12/20 (60%)
ZC3H6NP_940983.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105
ZnF_C3H1 276..297 CDD:214632 11/19 (58%)
ZnF_C3H1 303..327 CDD:214632 6/23 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..530 19/74 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 630..659
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 676..755
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 947..1026
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1051..1189
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.