DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and Zc3h3

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001128337.1 Gene:Zc3h3 / 300032 RGDID:1307276 Length:952 Species:Rattus norvegicus


Alignment Length:130 Identity:44/130 - (33%)
Similarity:68/130 - (52%) Gaps:7/130 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CNFITRNGQECDKGSACPFRHIRGDRTIVCKHWLRGLCKKGD-QCEFLHEYDMTKMPECYFYSRF 104
            |.:..|.|: |::|..||:.| ..::..||..::||.|||.| .|.|.|.....|||.|.::.: 
  Rat   669 CMYYNRFGR-CNRGECCPYIH-DPEKVAVCTRFVRGTCKKTDGSCPFSHHVSKEKMPVCSYFLK- 730

  Fly   105 NACHNKECPFLHIDPQSKVKDCPWYKRGFCRHGPHCRHQHLRRVLCMDYL-AGFCPEGPSCKHMH 168
            ..|.|..||:.|:....|.:.|..:.:|:|..|..|:.:|  .:||.|:. .|.||.|..|:.:|
  Rat   731 GICSNSNCPYSHVYVSRKAEVCGDFLKGYCPLGAKCKKKH--TLLCPDFARRGVCPRGTQCQLLH 793

  Fly   169  168
              Rat   794  793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 44/130 (34%)
ZnF_C3H1 66..90 CDD:214632 11/24 (46%)
Zc3h3NP_001128337.1 zf-CCCH 664..690 CDD:279036 8/22 (36%)
ZnF_C3H1 719..744 CDD:214632 9/25 (36%)
ZnF_C3H1 746..772 CDD:214632 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.