DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and Cpsf4l

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_038943379.1 Gene:Cpsf4l / 287799 RGDID:1306397 Length:226 Species:Rattus norvegicus


Alignment Length:187 Identity:93/187 - (49%)
Similarity:130/187 - (69%) Gaps:12/187 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDILLANVSGLQFKAERDLIEQVGAIPLPFYGMDKSIAAVCNFITRNGQECDKGSACPFRHIRGD 65
            |:.::|.:.|..|..|:|:..|.|...|||.|||||.:|||||..:.  .|.||..||.||.:|:
  Rat     1 MEEVIAGLQGFTFTFEQDVELQRGTGLLPFQGMDKSSSAVCNFFAKG--LCVKGMLCPLRHEQGE 63

  Fly    66 RTIVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLHIDPQSKVKDCPWYK 130
            :.:||||||||||:|.|.|.|||:||:::||.|||:|:|..|:||||||||:.|..|::|||||.
  Rat    64 KMVVCKHWLRGLCRKSDCCNFLHQYDVSRMPVCYFHSKFGNCNNKECPFLHLKPVPKLQDCPWYD 128

  Fly   131 RGFCRH-GPHCRHQHLRRVLCMDYLAGFCPEGPSCKHMHPHFELPPLAELGKDQLHK 186
            :|||:. ||.|:::|:.:|||.:|..||||:||.|:..||  ::.|:       ||:
  Rat   129 QGFCKEVGPLCKYRHVHQVLCPNYFIGFCPKGPKCQFGHP--KMSPI-------LHR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 87/163 (53%)
ZnF_C3H1 66..90 CDD:214632 16/23 (70%)
Cpsf4lXP_038943379.1 YTH1 <36..196 CDD:227416 78/152 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472764at2759
OrthoFinder 1 1.000 - - FOG0002750
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23102
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2133
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.