DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and yth1

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_592962.1 Gene:yth1 / 2541506 PomBaseID:SPAC227.08c Length:170 Species:Schizosaccharomyces pombe


Alignment Length:166 Identity:74/166 - (44%)
Similarity:94/166 - (56%) Gaps:29/166 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YGMDKSIAA--------VCNFITRN-----------GQECDKGSACPFRHIRGDRTIVCKHWLRG 76
            |..||:|||        ..|::.:|           |...|.||..        .::||||||||
pombe     4 YIKDKAIAADFSSVQFRFDNYLKQNFNFGRSALLNSGNGRDSGSKM--------GSVVCKHWLRG 60

  Fly    77 LCKKGDQCEFLHEYDMTKMPECYFYSRFNACHN-KECPFLHIDPQSKVKDCPWYKRGFCRHGPHC 140
            |||||:||:|||||::.|||.|:||:....|.| :||.:||:||..:|..|.||..|||..||.|
pombe    61 LCKKGEQCDFLHEYNLKKMPPCHFYAERGWCSNGEECLYLHLDPSKQVGVCAWYNMGFCPLGPIC 125

  Fly   141 RHQHLRRVL-CMDYLAGFCPEGPSCKHMHPHFELPP 175
            |.:|:|:.. |..|||||||.||:|...||....||
pombe   126 RGKHVRKPRPCPKYLAGFCPLGPNCPDAHPKHSEPP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 72/164 (44%)
ZnF_C3H1 66..90 CDD:214632 18/23 (78%)
yth1NP_592962.1 YTH1 1..170 CDD:227416 74/166 (45%)
ZnF_C3H1 50..74 CDD:214632 18/23 (78%)
zf-CCCH 77..101 CDD:279036 10/23 (43%)
ZnF_C3H1 131..156 CDD:214632 13/24 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I2900
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002750
OrthoInspector 1 1.000 - - oto100416
orthoMCL 1 0.900 - - OOG6_103251
Panther 1 1.100 - - LDO PTHR23102
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2013
SonicParanoid 1 1.000 - - X2133
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.