DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and SPBC337.12

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_595413.2 Gene:SPBC337.12 / 2540291 PomBaseID:SPBC337.12 Length:376 Species:Schizosaccharomyces pombe


Alignment Length:228 Identity:62/228 - (27%)
Similarity:90/228 - (39%) Gaps:50/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LANVSGLQF---KAERDLIEQV---GAIPLPFYGMDKSI----------------AAVCNFITRN 47
            |..:.|||:   .::...:|.|   |..|...|..:||.                |..|.:...|
pombe   150 LVTIDGLQYITGVSDTKWLEFVSAKGQCPKYLYWNNKSYLLKKKRFLKEVGNSPSAVYCRYYNAN 214

  Fly    48 GQECDKGSACPFRHIRGDRTIVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKEC 112
            | .|.||:||.|.| ...|..:|..:|.|.|.|.:.|...||.|..::|.|.:: ....|:|..|
pombe   215 G-ICGKGAACRFVH-EPTRKTICPKFLNGRCNKAEDCNLSHELDPRRIPACRYF-LLGKCNNPNC 276

  Fly   113 PFLHIDPQSKVKDC-PWYKRGFCRHGPHCRHQHLRRVLCMDY-LAGFCPEGPSCKHMH------- 168
            .::||........| .:.|.|||..|..|::||:  :.|.|| :.|.| ..|.|...|       
pombe   277 RYVHIHYSENAPICFEFAKYGFCELGTSCKNQHI--LQCTDYAMFGSC-NNPQCSLYHGAVSADV 338

  Fly   169 PHFELPPL-------------AELGKDQLHKKL 188
            |.....|:             :|:|.:.|...|
pombe   339 PEQTEAPISKTAGSINPEDSGSEIGSNSLESNL 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 54/193 (28%)
ZnF_C3H1 66..90 CDD:214632 8/23 (35%)
SPBC337.12NP_595413.2 YTH1 136..376 CDD:227416 62/228 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.